BLASTX nr result
ID: Cephaelis21_contig00003981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003981 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533760.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_002328132.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_003544784.1| PREDICTED: ser/Thr-rich protein T10 in DGCR ... 66 3e-09 ref|XP_003631559.1| PREDICTED: ser/Thr-rich protein T10 in DGCR ... 66 3e-09 gb|AFK33378.1| unknown [Lotus japonicus] gi|388512725|gb|AFK4442... 65 4e-09 >ref|XP_002533760.1| conserved hypothetical protein [Ricinus communis] gi|223526317|gb|EEF28619.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/36 (80%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 100 MCIGVFIWKAHPLHPFLLL-NRDEYHSRPTIPLAWW 204 MCI VF+W+AHPL+PFLLL NRDEYHSRPT PL+WW Sbjct: 1 MCIAVFLWQAHPLYPFLLLLNRDEYHSRPTKPLSWW 36 >ref|XP_002328132.1| predicted protein [Populus trichocarpa] gi|222837647|gb|EEE76012.1| predicted protein [Populus trichocarpa] Length = 262 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 100 MCIGVFIWKAHPLHPFLLL-NRDEYHSRPTIPLAWW 204 MCI VF+W+AHPL+PFLLL NRDEYHSRPT PL WW Sbjct: 1 MCIAVFLWQAHPLYPFLLLLNRDEYHSRPTKPLGWW 36 >ref|XP_003544784.1| PREDICTED: ser/Thr-rich protein T10 in DGCR region-like [Glycine max] Length = 270 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/36 (72%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 100 MCIGVFIWKAHPLHPFLLL-NRDEYHSRPTIPLAWW 204 MCI +F+W+AHPL+PFLLL NRDEYH+RPT P++WW Sbjct: 1 MCIALFLWQAHPLYPFLLLNNRDEYHNRPTKPVSWW 36 >ref|XP_003631559.1| PREDICTED: ser/Thr-rich protein T10 in DGCR region-like [Vitis vinifera] gi|297744476|emb|CBI37738.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 100 MCIGVFIWKAHPLHPFLLL-NRDEYHSRPTIPLAWW 204 MCI VF+W+AHP++PFLLL NRDEYH+RPT LAWW Sbjct: 1 MCIAVFLWQAHPIYPFLLLLNRDEYHNRPTEALAWW 36 >gb|AFK33378.1| unknown [Lotus japonicus] gi|388512725|gb|AFK44424.1| unknown [Lotus japonicus] Length = 271 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/36 (72%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 100 MCIGVFIWKAHPLHPFLLL-NRDEYHSRPTIPLAWW 204 MCI +F+W+AHPL+PFLLL NRDEYH+RPT P+ WW Sbjct: 1 MCIALFLWQAHPLYPFLLLNNRDEYHNRPTKPVEWW 36