BLASTX nr result
ID: Cephaelis21_contig00003869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003869 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537529.1| PREDICTED: 30S ribosomal protein S1 homolog ... 54 1e-05 ref|XP_002518629.1| hypothetical protein RCOM_1307020 [Ricinus c... 54 1e-05 >ref|XP_003537529.1| PREDICTED: 30S ribosomal protein S1 homolog [Glycine max] Length = 383 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 129 EVIQADDDSGKLIFSEKETLWSKFSPQIKVGDIFE 25 +VI AD+D+ KLIFSEKE WSKFS Q+ VGDIFE Sbjct: 157 KVILADEDNKKLIFSEKEAAWSKFSKQVNVGDIFE 191 >ref|XP_002518629.1| hypothetical protein RCOM_1307020 [Ricinus communis] gi|223542228|gb|EEF43771.1| hypothetical protein RCOM_1307020 [Ricinus communis] Length = 365 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 129 EVIQADDDSGKLIFSEKETLWSKFSPQIKVGDIFEGQ 19 +V+QA+++S KLIFSEKE WSKFS +IKVGDIF G+ Sbjct: 156 KVLQAEEESRKLIFSEKEAEWSKFSKRIKVGDIFVGR 192