BLASTX nr result
ID: Cephaelis21_contig00003731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003731 (702 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546983.1| PREDICTED: 60S ribosomal protein L38-like [G... 111 2e-22 gb|ADB02898.1| 60S ribosomal protein L38 [Jatropha curcas] 109 5e-22 ref|XP_004173568.1| PREDICTED: 60S ribosomal protein L38-like [C... 109 6e-22 ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38-like [V... 109 6e-22 ref|XP_003543572.1| PREDICTED: 60S ribosomal protein L38 [Glycin... 109 6e-22 >ref|XP_003546983.1| PREDICTED: 60S ribosomal protein L38-like [Glycine max] Length = 100 Score = 111 bits (277), Expect = 2e-22 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -1 Query: 600 TMPKQIHEIKDFLLTARRKDARSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 436 TMPKQIHEIKDFLLTARRKDARSVKIKR KDVVKFKVRCSKYLYTLCVFDSEKAD Sbjct: 31 TMPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKYLYTLCVFDSEKAD 85 >gb|ADB02898.1| 60S ribosomal protein L38 [Jatropha curcas] Length = 69 Score = 109 bits (273), Expect = 5e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 597 MPKQIHEIKDFLLTARRKDARSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 436 MPKQIHEIKDFLLTARRKDA SVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD Sbjct: 1 MPKQIHEIKDFLLTARRKDAHSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 54 >ref|XP_004173568.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] Length = 63 Score = 109 bits (272), Expect = 6e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 597 MPKQIHEIKDFLLTARRKDARSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 436 MPKQIHEIKDFLLTARRKDARSVKIKR KDVVKFKVRCSKYLYTLCVFDSEKAD Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKYLYTLCVFDSEKAD 54 >ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38-like [Vitis vinifera] gi|449442271|ref|XP_004138905.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] gi|449454586|ref|XP_004145035.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] gi|449506284|ref|XP_004162704.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] Length = 69 Score = 109 bits (272), Expect = 6e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 597 MPKQIHEIKDFLLTARRKDARSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 436 MPKQIHEIKDFLLTARRKDARSVKIKR KDVVKFKVRCSKYLYTLCVFDSEKAD Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKYLYTLCVFDSEKAD 54 >ref|XP_003543572.1| PREDICTED: 60S ribosomal protein L38 [Glycine max] Length = 69 Score = 109 bits (272), Expect = 6e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 597 MPKQIHEIKDFLLTARRKDARSVKIKRGKDVVKFKVRCSKYLYTLCVFDSEKAD 436 MPKQIHEIKDFLLTARRKDARSVKIKR KDVVKFKVRCSKYLYTLCVFDSEKAD Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKYLYTLCVFDSEKAD 54