BLASTX nr result
ID: Cephaelis21_contig00003633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003633 (652 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 153 2e-35 dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 153 2e-35 gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] 153 2e-35 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 153 3e-35 ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit ... 152 5e-35 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 153 bits (387), Expect = 2e-35 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -3 Query: 647 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 468 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 60 Query: 467 EPHIMLFRRPL 435 EPHIMLFRRPL Sbjct: 61 EPHIMLFRRPL 71 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 153 bits (387), Expect = 2e-35 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -3 Query: 647 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 468 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP Sbjct: 1204 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 1263 Query: 467 EPHIMLFRRPL 435 EPHIMLFRRPL Sbjct: 1264 EPHIMLFRRPL 1274 >gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] Length = 88 Score = 153 bits (387), Expect = 2e-35 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -3 Query: 647 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 468 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 60 Query: 467 EPHIMLFRRPL 435 EPHIMLFRRPL Sbjct: 61 EPHIMLFRRPL 71 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 153 bits (386), Expect = 3e-35 Identities = 70/71 (98%), Positives = 71/71 (100%) Frame = -3 Query: 647 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 468 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYA+HRP Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRP 60 Query: 467 EPHIMLFRRPL 435 EPHIMLFRRPL Sbjct: 61 EPHIMLFRRPL 71 >ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|355507367|gb|AES88509.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|388496380|gb|AFK36256.1| unknown [Medicago truncatula] Length = 88 Score = 152 bits (384), Expect = 5e-35 Identities = 70/71 (98%), Positives = 71/71 (100%) Frame = -3 Query: 647 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 468 MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP 60 Query: 467 EPHIMLFRRPL 435 EPHIMLFRRPL Sbjct: 61 EPHIMLFRRPL 71