BLASTX nr result
ID: Cephaelis21_contig00003600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003600 (921 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ33626.1| unnamed protein product [Thellungiella halophila] 58 3e-06 gb|ACP28875.1| glutathionine peroxidase 6 [Eutrema halophilum] 58 3e-06 gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] 58 3e-06 ref|NP_192897.2| glutathione peroxidase [Arabidopsis thaliana] g... 57 5e-06 dbj|BAA24226.1| phospholipid hydroperoxide glutathione peroxidas... 57 5e-06 >dbj|BAJ33626.1| unnamed protein product [Thellungiella halophila] Length = 234 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DFTVKDAKGNDVDLSKYKGKVLLIVNVASE 92 DFTVKDAKGNDVDLS YKGKVLLIVNVAS+ Sbjct: 77 DFTVKDAKGNDVDLSTYKGKVLLIVNVASQ 106 >gb|ACP28875.1| glutathionine peroxidase 6 [Eutrema halophilum] Length = 234 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DFTVKDAKGNDVDLSKYKGKVLLIVNVASE 92 DFTVKDAKGNDVDLS YKGKVLLIVNVAS+ Sbjct: 77 DFTVKDAKGNDVDLSTYKGKVLLIVNVASQ 106 >gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] Length = 168 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DFTVKDAKGNDVDLSKYKGKVLLIVNVASE 92 DFTVKDAKGNDVDLS YKGKVLLIVNVAS+ Sbjct: 12 DFTVKDAKGNDVDLSTYKGKVLLIVNVASQ 41 >ref|NP_192897.2| glutathione peroxidase [Arabidopsis thaliana] gi|47117812|sp|O48646.2|GPX6_ARATH RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial; Short=AtGPX1; Short=PHGPx; Flags: Precursor gi|14532478|gb|AAK63967.1| AT4g11600/T5C23_30 [Arabidopsis thaliana] gi|18655355|gb|AAL76133.1| AT4g11600/T5C23_30 [Arabidopsis thaliana] gi|332657629|gb|AEE83029.1| glutathione peroxidase [Arabidopsis thaliana] Length = 232 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DFTVKDAKGNDVDLSKYKGKVLLIVNVASE 92 DFTVKDAKGNDVDLS YKGKVLLIVNVAS+ Sbjct: 75 DFTVKDAKGNDVDLSIYKGKVLLIVNVASQ 104 >dbj|BAA24226.1| phospholipid hydroperoxide glutathione peroxidase-like protein [Arabidopsis thaliana] gi|3004869|gb|AAC09173.1| glutathione peroxidase [Arabidopsis thaliana] gi|4539451|emb|CAB39931.1| phospholipid hydroperoxide glutathione peroxidase [Arabidopsis thaliana] gi|7267860|emb|CAB78203.1| phospholipid hydroperoxide glutathione peroxidase [Arabidopsis thaliana] gi|21617919|gb|AAM66969.1| phospholipid hydroperoxide glutathione peroxidase [Arabidopsis thaliana] Length = 169 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DFTVKDAKGNDVDLSKYKGKVLLIVNVASE 92 DFTVKDAKGNDVDLS YKGKVLLIVNVAS+ Sbjct: 12 DFTVKDAKGNDVDLSIYKGKVLLIVNVASQ 41