BLASTX nr result
ID: Cephaelis21_contig00001491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001491 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI17896.1| invertase inhibitor [Coffea canephora] 68 7e-10 >gb|ABI17896.1| invertase inhibitor [Coffea canephora] Length = 185 Score = 68.2 bits (165), Expect = 7e-10 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = -3 Query: 179 MKPLFSSFPPLTALLFITFFSCSIPEAASQENLINQTCKAFVKDDPNINFNFCSTSLQA 3 M+P SS ALL F C I A SQENLI +C+ F KDDPNINFNFC+TSLQA Sbjct: 1 MRPSISS-----ALLITLFLLCFIHGATSQENLIRDSCRTFAKDDPNINFNFCTTSLQA 54