BLASTX nr result
ID: Cephaelis21_contig00001466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001466 (1012 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC06242.1| late embryogenis abundant protein 5 [Nicotiana ta... 62 3e-07 >gb|AAC06242.1| late embryogenis abundant protein 5 [Nicotiana tabacum] Length = 97 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 602 MSVMLKNGGGEESSNATTPWVPDPVTGYYRPESHANEIDPAE 477 +++M+K EESS TT WVPDPVTGYYRPESHA EID AE Sbjct: 45 VNIMMKKW--EESSKKTTSWVPDPVTGYYRPESHAKEIDAAE 84