BLASTX nr result
ID: Cephaelis21_contig00001091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001091 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629895.1| Ubiquitin [Medicago truncatula] gi|355523917... 105 2e-26 gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum] 105 2e-26 gb|EKM81732.1| hypothetical protein AGABI1DRAFT_111993 [Agaricus... 105 3e-26 gb|EIN09509.1| ubiquitin-domain-containing protein [Punctularia ... 105 3e-26 dbj|GAA93464.1| hypothetical protein E5Q_00105 [Mixia osmundae I... 105 4e-26 >ref|XP_003629895.1| Ubiquitin [Medicago truncatula] gi|355523917|gb|AET04371.1| Ubiquitin [Medicago truncatula] Length = 232 Score = 105 bits (262), Expect(3) = 2e-26 Identities = 51/68 (75%), Positives = 58/68 (85%) Frame = +3 Query: 150 QGQIQNKKGIPPDQQRLIFAGKHLNNDRTPTDYNI*KESTLHLILRL*GGAKKHKKKSYT 329 + +IQ+K+GIPPDQQRLIFAGK L + RT DYNI KESTLHL+LRL GGAKK KKK+YT Sbjct: 104 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYT 163 Query: 330 NPKKIKHK 353 PKKIKHK Sbjct: 164 KPKKIKHK 171 Score = 36.2 bits (82), Expect(3) = 2e-26 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 71 RMQIFVKTLMRKTITLEVESS 133 +MQIFVKTL KTITLEVESS Sbjct: 77 KMQIFVKTLTGKTITLEVESS 97 Score = 22.3 bits (46), Expect(3) = 2e-26 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 133 DTIDNVKAKSRTRK 174 DTIDNVKAK + ++ Sbjct: 98 DTIDNVKAKIQDKE 111 >gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum] Length = 179 Score = 105 bits (262), Expect(3) = 2e-26 Identities = 51/68 (75%), Positives = 58/68 (85%) Frame = +3 Query: 150 QGQIQNKKGIPPDQQRLIFAGKHLNNDRTPTDYNI*KESTLHLILRL*GGAKKHKKKSYT 329 + +IQ+K+GIPPDQQRLIFAGK L + RT DYNI KESTLHL+LRL GGAKK KKK+YT Sbjct: 50 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYT 109 Query: 330 NPKKIKHK 353 PKKIKHK Sbjct: 110 KPKKIKHK 117 Score = 36.2 bits (82), Expect(3) = 2e-26 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 71 RMQIFVKTLMRKTITLEVESS 133 +MQIFVKTL KTITLEVESS Sbjct: 23 KMQIFVKTLTGKTITLEVESS 43 Score = 22.3 bits (46), Expect(3) = 2e-26 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 133 DTIDNVKAKSRTRK 174 DTIDNVKAK + ++ Sbjct: 44 DTIDNVKAKIQDKE 57 >gb|EKM81732.1| hypothetical protein AGABI1DRAFT_111993 [Agaricus bisporus var. burnettii JB137-S8] gi|426196607|gb|EKV46535.1| hypothetical protein AGABI2DRAFT_193235 [Agaricus bisporus var. bisporus H97] Length = 159 Score = 105 bits (263), Expect(3) = 3e-26 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = +3 Query: 150 QGQIQNKKGIPPDQQRLIFAGKHLNNDRTPTDYNI*KESTLHLILRL*GGAKKHKKKSYT 329 + +IQ+K+GIPPDQQRLIFAGK L + RT +DYNI KESTLHL+LRL GGAKK KKK+YT Sbjct: 27 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYT 86 Query: 330 NPKKIKHK 353 PKKIKHK Sbjct: 87 TPKKIKHK 94 Score = 35.4 bits (80), Expect(3) = 3e-26 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 74 MQIFVKTLMRKTITLEVESS 133 MQIFVKTL KTITLEVESS Sbjct: 1 MQIFVKTLTGKTITLEVESS 20 Score = 22.3 bits (46), Expect(3) = 3e-26 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 133 DTIDNVKAKSRTRK 174 DTIDNVKAK + ++ Sbjct: 21 DTIDNVKAKIQDKE 34 >gb|EIN09509.1| ubiquitin-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] Length = 158 Score = 105 bits (263), Expect(3) = 3e-26 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = +3 Query: 150 QGQIQNKKGIPPDQQRLIFAGKHLNNDRTPTDYNI*KESTLHLILRL*GGAKKHKKKSYT 329 + +IQ+K+GIPPDQQRLIFAGK L + RT +DYNI KESTLHL+LRL GGAKK KKK+YT Sbjct: 27 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYT 86 Query: 330 NPKKIKHK 353 PKKIKHK Sbjct: 87 TPKKIKHK 94 Score = 35.4 bits (80), Expect(3) = 3e-26 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 74 MQIFVKTLMRKTITLEVESS 133 MQIFVKTL KTITLEVESS Sbjct: 1 MQIFVKTLTGKTITLEVESS 20 Score = 22.3 bits (46), Expect(3) = 3e-26 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 133 DTIDNVKAKSRTRK 174 DTIDNVKAK + ++ Sbjct: 21 DTIDNVKAKIQDKE 34 >dbj|GAA93464.1| hypothetical protein E5Q_00105 [Mixia osmundae IAM 14324] Length = 331 Score = 105 bits (262), Expect(3) = 4e-26 Identities = 51/68 (75%), Positives = 58/68 (85%) Frame = +3 Query: 150 QGQIQNKKGIPPDQQRLIFAGKHLNNDRTPTDYNI*KESTLHLILRL*GGAKKHKKKSYT 329 + +IQ+K+GIPPDQQRLIFAGK L + RT +DYNI KESTLHL+LRL GGAKK KKK YT Sbjct: 199 KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKQYT 258 Query: 330 NPKKIKHK 353 PKKIKHK Sbjct: 259 TPKKIKHK 266 Score = 35.4 bits (80), Expect(3) = 4e-26 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 74 MQIFVKTLMRKTITLEVESS 133 MQIFVKTL KTITLEVESS Sbjct: 173 MQIFVKTLTGKTITLEVESS 192 Score = 22.3 bits (46), Expect(3) = 4e-26 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 133 DTIDNVKAKSRTRK 174 DTIDNVKAK + ++ Sbjct: 193 DTIDNVKAKIQDKE 206