BLASTX nr result
ID: Cephaelis21_contig00000830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000830 (731 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002877160.1| hypothetical protein ARALYDRAFT_905208 [Arab... 57 5e-06 ref|NP_566844.1| uncharacterized protein [Arabidopsis thaliana] ... 57 5e-06 ref|XP_004141452.1| PREDICTED: transmembrane protein 230-like [C... 56 7e-06 ref|XP_002460961.1| hypothetical protein SORBIDRAFT_02g038255 [S... 56 9e-06 >ref|XP_002877160.1| hypothetical protein ARALYDRAFT_905208 [Arabidopsis lyrata subsp. lyrata] gi|297322998|gb|EFH53419.1| hypothetical protein ARALYDRAFT_905208 [Arabidopsis lyrata subsp. lyrata] Length = 121 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +1 Query: 433 GHLLLHKQPLSMLAGFYETQIAYCSWRGAQGYRFASIPDY 552 G+ LL L+ L GFYET+IAY SWRGA+GYRFA+IP Y Sbjct: 82 GYALLVLGILTFLPGFYETRIAYYSWRGAEGYRFAAIPSY 121 >ref|NP_566844.1| uncharacterized protein [Arabidopsis thaliana] gi|9294037|dbj|BAB01994.1| unnamed protein product [Arabidopsis thaliana] gi|21537038|gb|AAM61379.1| unknown [Arabidopsis thaliana] gi|51971585|dbj|BAD44457.1| unknown protein [Arabidopsis thaliana] gi|51971745|dbj|BAD44537.1| unknown protein [Arabidopsis thaliana] gi|114050555|gb|ABI49427.1| At3g29170 [Arabidopsis thaliana] gi|332644024|gb|AEE77545.1| uncharacterized protein [Arabidopsis thaliana] Length = 121 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +1 Query: 433 GHLLLHKQPLSMLAGFYETQIAYCSWRGAQGYRFASIPDY 552 G+ LL L+ L GFYET+IAY SWRGA+GYRFA+IP Y Sbjct: 82 GYALLVLGILTFLPGFYETRIAYYSWRGAEGYRFAAIPSY 121 >ref|XP_004141452.1| PREDICTED: transmembrane protein 230-like [Cucumis sativus] gi|449481352|ref|XP_004156157.1| PREDICTED: transmembrane protein 230-like [Cucumis sativus] Length = 116 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 460 LSMLAGFYETQIAYCSWRGAQGYRFASIPDY 552 L+ L GFYET+IAY +WRGA GYRFASIPDY Sbjct: 86 LTFLPGFYETRIAYYAWRGANGYRFASIPDY 116 >ref|XP_002460961.1| hypothetical protein SORBIDRAFT_02g038255 [Sorghum bicolor] gi|241924338|gb|EER97482.1| hypothetical protein SORBIDRAFT_02g038255 [Sorghum bicolor] Length = 93 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 442 LLHKQPLSMLAGFYETQIAYCSWRGAQGYRFASIPDY 552 LL L+ L G+YET++AY SWRGAQGY FASIPDY Sbjct: 57 LLFLGVLAFLPGYYETRVAYYSWRGAQGYTFASIPDY 93