BLASTX nr result
ID: Cephaelis21_contig00000813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000813 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 >ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 719 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%) Frame = -3 Query: 235 MTLRLRPPTAPFNLSSRNLEKFVKTQKNLSKPTPKLWHDTG-GVDDQDNNGFRILQLSHP 59 M +R +P LSS +LEKF+K++KNL K P+LW D G G+ ++D+ IL+LSHP Sbjct: 1 MGVRFKPSHPTVRLSSLSLEKFLKSRKNLFKAPPRLWSDHGHGLPEEDDQPLPILKLSHP 60 Query: 58 ILRILDLISPNLYHFNQV 5 ILR L+ + FNQ+ Sbjct: 61 ILRTLESCCGSTKEFNQI 78