BLASTX nr result
ID: Cephaelis21_contig00000669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000669 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169107.1| PREDICTED: nuclear transcription factor Y su... 69 4e-10 ref|XP_004137802.1| PREDICTED: nuclear transcription factor Y su... 69 4e-10 ref|XP_002278716.1| PREDICTED: nuclear transcription factor Y su... 69 4e-10 ref|XP_002278772.1| PREDICTED: nuclear transcription factor Y su... 69 4e-10 emb|CBI31520.3| unnamed protein product [Vitis vinifera] 69 4e-10 >ref|XP_004169107.1| PREDICTED: nuclear transcription factor Y subunit B-8-like, partial [Cucumis sativus] Length = 121 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 DQSPQLNVREQDRFLPIANIGRIMKKALPANGKIAKEA 3 +QSP+ NVREQDRFLPIANI RIMKKALPANGKIAK+A Sbjct: 17 EQSPRSNVREQDRFLPIANISRIMKKALPANGKIAKDA 54 >ref|XP_004137802.1| PREDICTED: nuclear transcription factor Y subunit B-8-like [Cucumis sativus] Length = 173 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 DQSPQLNVREQDRFLPIANIGRIMKKALPANGKIAKEA 3 +QSP+ NVREQDRFLPIANI RIMKKALPANGKIAK+A Sbjct: 17 EQSPRSNVREQDRFLPIANISRIMKKALPANGKIAKDA 54 >ref|XP_002278716.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 1 [Vitis vinifera] gi|359486707|ref|XP_003633465.1| PREDICTED: nuclear transcription factor Y subunit B-8-like [Vitis vinifera] Length = 178 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 DQSPQLNVREQDRFLPIANIGRIMKKALPANGKIAKEA 3 DQSP+ NVREQDR+LPIANI RIMKKALPANGKIAK+A Sbjct: 18 DQSPRHNVREQDRYLPIANISRIMKKALPANGKIAKDA 55 >ref|XP_002278772.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 2 [Vitis vinifera] Length = 161 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 DQSPQLNVREQDRFLPIANIGRIMKKALPANGKIAKEA 3 DQSP+ NVREQDR+LPIANI RIMKKALPANGKIAK+A Sbjct: 18 DQSPRHNVREQDRYLPIANISRIMKKALPANGKIAKDA 55 >emb|CBI31520.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 DQSPQLNVREQDRFLPIANIGRIMKKALPANGKIAKEA 3 DQSP+ NVREQDR+LPIANI RIMKKALPANGKIAK+A Sbjct: 18 DQSPRHNVREQDRYLPIANISRIMKKALPANGKIAKDA 55