BLASTX nr result
ID: Cephaelis21_contig00000652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000652 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 91 1e-16 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 87 1e-15 gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] 84 1e-14 gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 82 5e-14 emb|CCH50954.1| T1.2 [Malus x robusta] 81 8e-14 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 300 KNNKAIGPDDMLIDAWKCLTKVGITWLTKIFSLIIHTKKLPKQWRKSVLIPLYKNKRDIQ 121 K+ KAIGPDD+ I+ WK L + GITWLT +F+ I+ TKK+P +WR S L+P+YKNK D+Q Sbjct: 573 KHRKAIGPDDIPIEVWKVLGETGITWLTDLFNRILKTKKMPNEWRTSTLVPIYKNKGDVQ 632 Query: 120 NC 115 NC Sbjct: 633 NC 634 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus x domestica] Length = 622 Score = 87.0 bits (214), Expect = 1e-15 Identities = 35/62 (56%), Positives = 48/62 (77%) Frame = -2 Query: 300 KNNKAIGPDDMLIDAWKCLTKVGITWLTKIFSLIIHTKKLPKQWRKSVLIPLYKNKRDIQ 121 K+ KA+GPDD+ I+ WK L + GITWL +F+ I+ TKK+P +WR S L+P+YKNK D+Q Sbjct: 177 KHRKAVGPDDIPIEVWKVLGETGITWLIDLFNRILKTKKMPNEWRTSPLVPIYKNKGDVQ 236 Query: 120 NC 115 NC Sbjct: 237 NC 238 >gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 562 Score = 84.0 bits (206), Expect = 1e-14 Identities = 34/62 (54%), Positives = 50/62 (80%) Frame = -2 Query: 300 KNNKAIGPDDMLIDAWKCLTKVGITWLTKIFSLIIHTKKLPKQWRKSVLIPLYKNKRDIQ 121 KN++A+GPD++ I+ WK L + I WLTK+F+ I+ +KK+P +WRKS L+P+YKNK DIQ Sbjct: 67 KNDRAVGPDNIPIEVWKDLGEKDINWLTKLFNEILRSKKMPGEWRKSTLVPIYKNKGDIQ 126 Query: 120 NC 115 +C Sbjct: 127 SC 128 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/62 (56%), Positives = 48/62 (77%) Frame = -2 Query: 297 NNKAIGPDDMLIDAWKCLTKVGITWLTKIFSLIIHTKKLPKQWRKSVLIPLYKNKRDIQN 118 N KA+GPD++ I+ WK L GI WLTK+F+ I+ TKK+ +WR+S LIP+YKNK DIQ+ Sbjct: 31 NGKAVGPDNIPIEVWKSLGDRGIVWLTKLFNEIMKTKKMLDEWRRSTLIPIYKNKGDIQH 90 Query: 117 CS 112 C+ Sbjct: 91 CA 92 >emb|CCH50954.1| T1.2 [Malus x robusta] Length = 554 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = -2 Query: 300 KNNKAIGPDDMLIDAWKCLTKVGITWLTKIFSLIIHTKKLPKQWRKSVLIPLYKNKRDIQ 121 K+ KA+GP+D+ I WK L + GITWLT +F+ I+ KK+ +WR S L+P+YKNK DIQ Sbjct: 196 KHIKAVGPNDIPIKVWKVLGETGITWLTDLFNRILKMKKMSNEWRNSTLVPIYKNKGDIQ 255 Query: 120 NC 115 NC Sbjct: 256 NC 257