BLASTX nr result
ID: Cephaelis21_contig00000525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000525 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525713.1| sgd1p, putative [Ricinus communis] gi|223535... 65 2e-08 emb|CBI31217.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002269480.1| PREDICTED: nucleolar MIF4G domain-containing... 64 3e-08 gb|EEC78512.1| hypothetical protein OsI_18447 [Oryza sativa Indi... 62 1e-07 emb|CAN80269.1| hypothetical protein VITISV_020031 [Vitis vinifera] 62 1e-07 >ref|XP_002525713.1| sgd1p, putative [Ricinus communis] gi|223535013|gb|EEF36696.1| sgd1p, putative [Ricinus communis] Length = 746 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 650 KMEFMLETICEIKNNKKRPKEETVQHTRIKK*LQK 546 +MEFMLETIC+IKNNK+RPKE+T QHTRIKK LQK Sbjct: 446 RMEFMLETICDIKNNKRRPKEDTAQHTRIKKWLQK 480 >emb|CBI31217.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 650 KMEFMLETICEIKNNKKRPKEETVQHTRIKK*LQK 546 +MEFMLETIC+IKNNKKR KEETVQHTRI K LQK Sbjct: 236 RMEFMLETICDIKNNKKRTKEETVQHTRINKWLQK 270 >ref|XP_002269480.1| PREDICTED: nucleolar MIF4G domain-containing protein 1 [Vitis vinifera] Length = 700 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 650 KMEFMLETICEIKNNKKRPKEETVQHTRIKK*LQK 546 +MEFMLETIC+IKNNKKR KEETVQHTRI K LQK Sbjct: 400 RMEFMLETICDIKNNKKRTKEETVQHTRINKWLQK 434 >gb|EEC78512.1| hypothetical protein OsI_18447 [Oryza sativa Indica Group] gi|222630187|gb|EEE62319.1| hypothetical protein OsJ_17108 [Oryza sativa Japonica Group] Length = 764 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 650 KMEFMLETICEIKNNKKRPKEETVQHTRIKK*LQK 546 +MEFMLETIC+IKNNKKRPKE+ HTRIKK LQK Sbjct: 463 RMEFMLETICDIKNNKKRPKEDPAHHTRIKKWLQK 497 >emb|CAN80269.1| hypothetical protein VITISV_020031 [Vitis vinifera] Length = 700 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 650 KMEFMLETICEIKNNKKRPKEETVQHTRIKK*LQK 546 +MEFMLETIC+IKNNKKR KEET QHTRI K LQK Sbjct: 400 RMEFMLETICDIKNNKKRTKEETXQHTRINKWLQK 434