BLASTX nr result
ID: Cephaelis21_contig00000465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000465 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC69417.1| CYP72A54 [Nicotiana tabacum] 75 5e-12 ref|XP_002458200.1| hypothetical protein SORBIDRAFT_03g028610 [S... 74 9e-12 ref|XP_002458199.1| hypothetical protein SORBIDRAFT_03g028600 [S... 74 9e-12 gb|AAZ03640.1| putative cytochrome P450 [Eustoma exaltatum subsp... 73 2e-11 tpg|DAA58486.1| TPA: putative cytochrome P450 superfamily protei... 73 3e-11 >gb|ABC69417.1| CYP72A54 [Nicotiana tabacum] Length = 517 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 311 LEAKMALAVILQKFSMELSPSYAHAPYTFITLQPQHGAQLMLRKL 177 LEAKMALA+ILQ ++ ELSPSYAHAP+T ITLQPQHGA L+LRKL Sbjct: 473 LEAKMALALILQHYAFELSPSYAHAPHTIITLQPQHGAPLILRKL 517 >ref|XP_002458200.1| hypothetical protein SORBIDRAFT_03g028610 [Sorghum bicolor] gi|241930175|gb|EES03320.1| hypothetical protein SORBIDRAFT_03g028610 [Sorghum bicolor] Length = 525 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -2 Query: 311 LEAKMALAVILQKFSMELSPSYAHAPYTFITLQPQHGAQLMLRKL 177 LEAKMAL ILQ+FS ELSPSY HAPYT ITL PQHGAQ+ L+KL Sbjct: 481 LEAKMALCTILQRFSFELSPSYTHAPYTVITLHPQHGAQIRLKKL 525 >ref|XP_002458199.1| hypothetical protein SORBIDRAFT_03g028600 [Sorghum bicolor] gi|241930174|gb|EES03319.1| hypothetical protein SORBIDRAFT_03g028600 [Sorghum bicolor] Length = 538 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -2 Query: 311 LEAKMALAVILQKFSMELSPSYAHAPYTFITLQPQHGAQLMLRKL 177 LEAKMAL ILQ+FS ELSPSY HAPYT ITL PQHGAQ+ L+KL Sbjct: 494 LEAKMALCTILQRFSFELSPSYTHAPYTVITLHPQHGAQIRLKKL 538 >gb|AAZ03640.1| putative cytochrome P450 [Eustoma exaltatum subsp. russellianum] Length = 74 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 311 LEAKMALAVILQKFSMELSPSYAHAPYTFITLQPQHGAQLMLRKL 177 LEAKMAL+ ILQ+FS ELSPSY HAPYT +TL PQHGA +ML+K+ Sbjct: 30 LEAKMALSTILQRFSFELSPSYTHAPYTVLTLHPQHGAPIMLKKI 74 >tpg|DAA58486.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 141 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -2 Query: 311 LEAKMALAVILQKFSMELSPSYAHAPYTFITLQPQHGAQLMLRKL 177 LEAKM L ILQ+FS ELSPSY HAPYT ITL PQHGAQ+ L+KL Sbjct: 95 LEAKMTLCTILQRFSFELSPSYTHAPYTVITLHPQHGAQIRLKKL 139