BLASTX nr result
ID: Cephaelis21_contig00000253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000253 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152814.1| PREDICTED: splicing factor 3B subunit 2-like... 54 5e-07 >ref|XP_004152814.1| PREDICTED: splicing factor 3B subunit 2-like [Cucumis sativus] gi|449515207|ref|XP_004164641.1| PREDICTED: splicing factor 3B subunit 2-like [Cucumis sativus] Length = 580 Score = 54.3 bits (129), Expect(2) = 5e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +1 Query: 289 LEQVEVVYVPEKT*LDGDLTEEFRKVFEKFSFKDTAGSE 405 +E+VE+ Y+PEK LD L E+FRKVFEKFSF + AG+E Sbjct: 78 VEKVEIEYIPEKAELDDSLDEDFRKVFEKFSFSEVAGAE 116 Score = 24.3 bits (51), Expect(2) = 5e-07 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 497 KNEKKDETAQDAASK 541 +NE KDE+AQ+A SK Sbjct: 117 ENEDKDESAQNATSK 131