BLASTX nr result
ID: Cephaelis21_contig00000017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000017 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273014.1| PREDICTED: uncharacterized protein LOC100253... 68 7e-10 ref|NP_173042.1| uncharacterized protein [Arabidopsis thaliana] ... 62 5e-08 ref|XP_002890135.1| hypothetical protein ARALYDRAFT_312580 [Arab... 60 2e-07 ref|XP_002527309.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002273014.1| PREDICTED: uncharacterized protein LOC100253325 [Vitis vinifera] Length = 111 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +2 Query: 158 MGNGDDWLALDKLYHVVFGFCTTIIFTLLASRTRYAFIRNRSTWVGSMLS 307 M NGDDW+A+DK+YH++F T+IF+ LA+RTRY F+R S WV S+LS Sbjct: 1 MENGDDWVAVDKVYHILFCSALTLIFSALANRTRYPFLRRYSVWVASILS 50 >ref|NP_173042.1| uncharacterized protein [Arabidopsis thaliana] gi|332191260|gb|AEE29381.1| uncharacterized protein [Arabidopsis thaliana] Length = 113 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 161 GNGDD-WLALDKLYHVVFGFCTTIIFTLLASRTRYAFIRNRSTWVGSMLS 307 G+G+D WLA DKLYHV+F F ++IF+ LAS +RY+F+R S W+GS S Sbjct: 8 GDGEDPWLARDKLYHVIFCFSISLIFSTLASFSRYSFLRRHSIWIGSAFS 57 >ref|XP_002890135.1| hypothetical protein ARALYDRAFT_312580 [Arabidopsis lyrata subsp. lyrata] gi|297335977|gb|EFH66394.1| hypothetical protein ARALYDRAFT_312580 [Arabidopsis lyrata subsp. lyrata] Length = 113 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +2 Query: 170 DDWLALDKLYHVVFGFCTTIIFTLLASRTRYAFIRNRSTWVGSMLS 307 D WLA DK+YHVVF F +++F+ LAS +RY+F+R S W+GS S Sbjct: 12 DPWLAADKVYHVVFCFSISLLFSTLASLSRYSFLRRHSIWIGSAFS 57 >ref|XP_002527309.1| conserved hypothetical protein [Ricinus communis] gi|223533309|gb|EEF35061.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +2 Query: 170 DDWLALDKLYHVVFGFCTTIIFTLLASRTRYAFIRNRSTWVGSMLS 307 D WLA DKLYH++F T+ F+ LAS TR++F+RN S +GS+LS Sbjct: 8 DPWLAPDKLYHILFCLFLTLFFSKLASLTRHSFLRNHSIRIGSILS 53