BLASTX nr result
ID: Catharanthus23_contig00041111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00041111 (245 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338730.1| PREDICTED: mitochondrial phosphate carrier p... 67 2e-09 gb|ESW33639.1| hypothetical protein PHAVU_001G086600g [Phaseolus... 67 2e-09 ref|XP_006446959.1| hypothetical protein CICLE_v10015678mg [Citr... 67 2e-09 ref|XP_006408567.1| hypothetical protein EUTSA_v10020809mg [Eutr... 67 2e-09 ref|XP_002300143.2| mitochondrial phosphate transporter family p... 67 2e-09 ref|XP_002318765.2| hypothetical protein POPTR_0012s10690g [Popu... 67 2e-09 ref|XP_006373106.1| hypothetical protein POPTR_0017s08780g [Popu... 67 2e-09 gb|EPS57923.1| hypothetical protein M569_16894, partial [Genlise... 67 2e-09 gb|EOY02921.1| Phosphate transporter 3,1 [Theobroma cacao] 67 2e-09 ref|XP_004493018.1| PREDICTED: mitochondrial phosphate carrier p... 67 2e-09 ref|XP_004493017.1| PREDICTED: mitochondrial phosphate carrier p... 67 2e-09 ref|XP_006298042.1| hypothetical protein CARUB_v10014087mg [Caps... 67 2e-09 ref|XP_004304559.1| PREDICTED: phosphate carrier protein, mitoch... 67 2e-09 gb|EMJ16756.1| hypothetical protein PRUPE_ppa007340mg [Prunus pe... 67 2e-09 ref|NP_001266267.1| phosphate carrier protein, mitochondrial-lik... 67 2e-09 ref|XP_004143758.1| PREDICTED: phosphate carrier protein, mitoch... 67 2e-09 gb|AGC00815.1| phosphate transporter, partial [Mesembryanthemum ... 67 2e-09 ref|XP_003624478.1| Phosphate carrier protein [Medicago truncatu... 67 2e-09 dbj|BAB83689.1| mitochondrial phosphate transporter [Lotus japon... 67 2e-09 ref|NP_001237304.1| mitochondrial phosphate transporter [Glycine... 67 2e-09 >ref|XP_006338730.1| PREDICTED: mitochondrial phosphate carrier protein 3, mitochondrial-like [Solanum tuberosum] Length = 361 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 311 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 342 >gb|ESW33639.1| hypothetical protein PHAVU_001G086600g [Phaseolus vulgaris] Length = 374 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 322 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 353 >ref|XP_006446959.1| hypothetical protein CICLE_v10015678mg [Citrus clementina] gi|557549570|gb|ESR60199.1| hypothetical protein CICLE_v10015678mg [Citrus clementina] Length = 368 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 316 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 347 >ref|XP_006408567.1| hypothetical protein EUTSA_v10020809mg [Eutrema salsugineum] gi|557109713|gb|ESQ50020.1| hypothetical protein EUTSA_v10020809mg [Eutrema salsugineum] Length = 420 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 370 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 401 >ref|XP_002300143.2| mitochondrial phosphate transporter family protein [Populus trichocarpa] gi|550348746|gb|EEE84948.2| mitochondrial phosphate transporter family protein [Populus trichocarpa] Length = 366 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 320 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 351 >ref|XP_002318765.2| hypothetical protein POPTR_0012s10690g [Populus trichocarpa] gi|550326822|gb|EEE96985.2| hypothetical protein POPTR_0012s10690g [Populus trichocarpa] Length = 364 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 318 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 349 >ref|XP_006373106.1| hypothetical protein POPTR_0017s08780g [Populus trichocarpa] gi|550319812|gb|ERP50903.1| hypothetical protein POPTR_0017s08780g [Populus trichocarpa] Length = 374 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 321 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 352 >gb|EPS57923.1| hypothetical protein M569_16894, partial [Genlisea aurea] Length = 130 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 82 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 113 >gb|EOY02921.1| Phosphate transporter 3,1 [Theobroma cacao] Length = 372 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 329 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 360 >ref|XP_004493018.1| PREDICTED: mitochondrial phosphate carrier protein 3, mitochondrial-like isoform X2 [Cicer arietinum] Length = 346 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 315 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 346 >ref|XP_004493017.1| PREDICTED: mitochondrial phosphate carrier protein 3, mitochondrial-like isoform X1 [Cicer arietinum] Length = 366 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 315 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 346 >ref|XP_006298042.1| hypothetical protein CARUB_v10014087mg [Capsella rubella] gi|482566751|gb|EOA30940.1| hypothetical protein CARUB_v10014087mg [Capsella rubella] Length = 347 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 316 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 347 >ref|XP_004304559.1| PREDICTED: phosphate carrier protein, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 379 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 323 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 354 >gb|EMJ16756.1| hypothetical protein PRUPE_ppa007340mg [Prunus persica] Length = 372 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 322 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 353 >ref|NP_001266267.1| phosphate carrier protein, mitochondrial-like [Solanum lycopersicum] gi|402768974|gb|AFQ98279.1| phosphorus transporter [Solanum lycopersicum] Length = 358 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 308 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 339 >ref|XP_004143758.1| PREDICTED: phosphate carrier protein, mitochondrial-like [Cucumis sativus] gi|449515043|ref|XP_004164559.1| PREDICTED: phosphate carrier protein, mitochondrial-like [Cucumis sativus] Length = 370 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 317 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 348 >gb|AGC00815.1| phosphate transporter, partial [Mesembryanthemum crystallinum] Length = 357 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 321 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 352 >ref|XP_003624478.1| Phosphate carrier protein [Medicago truncatula] gi|87240702|gb|ABD32560.1| Mitochondrial substrate carrier [Medicago truncatula] gi|355499493|gb|AES80696.1| Phosphate carrier protein [Medicago truncatula] Length = 373 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 325 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 356 >dbj|BAB83689.1| mitochondrial phosphate transporter [Lotus japonicus] Length = 356 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 311 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 342 >ref|NP_001237304.1| mitochondrial phosphate transporter [Glycine max] gi|3318611|dbj|BAA31582.1| mitochondrial phosphate transporter [Glycine max] Length = 375 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 FTRGLPLRIVMIGTLTGVQWGIYDAFKVFVGL 97 FTRGLPLRIVMIGTLTG QWGIYDAFKVFVGL Sbjct: 323 FTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGL 354