BLASTX nr result
ID: Catharanthus23_contig00040172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00040172 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17691.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002272273.1| PREDICTED: uncharacterized protein LOC100254... 68 1e-09 ref|XP_002328016.1| predicted protein [Populus trichocarpa] 65 1e-08 ref|XP_006372802.1| hypothetical protein POPTR_0017s05180g [Popu... 64 2e-08 ref|XP_002309779.2| hypothetical protein POPTR_0007s01600g, part... 62 8e-08 ref|XP_002533839.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >emb|CBI17691.3| unnamed protein product [Vitis vinifera] Length = 531 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 + YGGFL +T CK D RKLK+KRSPC++ CY W +L+A FFT LA+ Sbjct: 97 VGYGGFLLVTTIWCKRDKRKLKKKRSPCYKQCYLWHILLASFFTILAI 144 >ref|XP_002272273.1| PREDICTED: uncharacterized protein LOC100254306 [Vitis vinifera] Length = 647 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 + YGGFL +T CK D RKLK+KRSPC++ CY W +L+A FFT LA+ Sbjct: 213 VGYGGFLLVTTIWCKRDKRKLKKKRSPCYKQCYLWHILLASFFTILAI 260 >ref|XP_002328016.1| predicted protein [Populus trichocarpa] Length = 552 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 +AYGGFL T FCCK + +KR PCH+ CY W +L+A+FFT LA+ Sbjct: 123 IAYGGFLLATVFCCKNRRNEKLKKRLPCHKQCYLWPILLAIFFTILAI 170 >ref|XP_006372802.1| hypothetical protein POPTR_0017s05180g [Populus trichocarpa] gi|550319450|gb|ERP50599.1| hypothetical protein POPTR_0017s05180g [Populus trichocarpa] Length = 552 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 +AYGGFL T FCCK + +KR PCH+ CY W +L+A+FFT LA+ Sbjct: 123 IAYGGFLLATVFCCKNRRNEKLKKRLPCHKQCYLWPLLLAIFFTILAI 170 >ref|XP_002309779.2| hypothetical protein POPTR_0007s01600g, partial [Populus trichocarpa] gi|550333903|gb|EEE90229.2| hypothetical protein POPTR_0007s01600g, partial [Populus trichocarpa] Length = 490 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 +AYGGFL FCCK ++KR PCH+ CY W +L+A+FFT LA+ Sbjct: 102 IAYGGFLLALAFCCKTRRYGQQKKRLPCHKQCYLWPILLAIFFTILAI 149 >ref|XP_002533839.1| conserved hypothetical protein [Ricinus communis] gi|223526218|gb|EEF28541.1| conserved hypothetical protein [Ricinus communis] Length = 523 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = +1 Query: 1 LAYGGFLSITKFCCKYDGRKLKQKRSPCHRHCYFWLVLIAVFFTFLAM 144 + YGG L +K+CCK KL KR PCH+ CY W +L+A+ FT L + Sbjct: 99 IVYGGVLIASKYCCKSRKEKLT-KRLPCHKQCYLWPILLAIIFTVLTL 145