BLASTX nr result
ID: Catharanthus23_contig00039175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00039175 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235929.1| PREDICTED: uncharacterized protein At2g39795... 64 2e-08 ref|XP_006341366.1| PREDICTED: uncharacterized protein At2g39795... 62 6e-08 ref|XP_004303256.1| PREDICTED: uncharacterized protein At2g39795... 61 1e-07 gb|EPS72644.1| hypothetical protein M569_02113 [Genlisea aurea] 61 2e-07 ref|XP_002527315.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_006465203.1| PREDICTED: uncharacterized protein At2g39795... 57 2e-06 ref|XP_006427587.1| hypothetical protein CICLE_v10026378mg [Citr... 57 2e-06 ref|XP_002299266.1| mitochondrial glycoprotein [Populus trichoca... 57 2e-06 ref|XP_002274018.1| PREDICTED: uncharacterized protein At2g39795... 57 3e-06 >ref|XP_004235929.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Solanum lycopersicum] Length = 230 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = -1 Query: 183 MAHRLMRPLRWTIVSVLRQPKLTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEIQYELD 4 MA RL+RPLR SVL Q + V TRNY+SEMR+EAFE N+LRL+R EI+YEL+ Sbjct: 3 MARRLVRPLRGIAKSVLLQQQ-PQPVIFNFTRNYISEMRREAFEENILRLLRYEIRYELE 61 >ref|XP_006341366.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Solanum tuberosum] Length = 230 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -1 Query: 183 MAHRLMRPLRWTIVSVLRQPKLTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEIQYELD 4 MA RL+RPLR VL Q + V TRNY+SEMR+EAFE N+LRL+R EI+YEL+ Sbjct: 3 MARRLVRPLRGIAKRVLLQQQ-PQPVIFNFTRNYISEMRREAFEENILRLLRYEIRYELE 61 >ref|XP_004303256.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 250 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/73 (49%), Positives = 43/73 (58%), Gaps = 15/73 (20%) Frame = -1 Query: 174 RLMRPLRWTIV---------------SVLRQPKLTSTVNSTITRNYVSEMRKEAFEANVL 40 RL+RPLR +I S+L K S N + R Y+SEMRK AFE N+L Sbjct: 3 RLIRPLRSSISRPSSSSKILIPQLPSSLLAPEKPVSFKNPLLVRTYISEMRKSAFEGNML 62 Query: 39 RLIRNEIQYELDR 1 RL+RNEIQYELDR Sbjct: 63 RLLRNEIQYELDR 75 >gb|EPS72644.1| hypothetical protein M569_02113 [Genlisea aurea] Length = 227 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/62 (51%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = -1 Query: 183 MAHRLMRPLRWTIVSVLRQPKLTSTVNST--ITRNYVSEMRKEAFEANVLRLIRNEIQYE 10 MAHR +R LR + + + Q + + + T NY SEMRK AFE N+LRLIRNEIQYE Sbjct: 1 MAHRNLRGLRGAVKNFVEQRRTNPRIQNFQYCTGNYASEMRKRAFEGNILRLIRNEIQYE 60 Query: 9 LD 4 D Sbjct: 61 AD 62 >ref|XP_002527315.1| conserved hypothetical protein [Ricinus communis] gi|223533315|gb|EEF35067.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 15/73 (20%) Frame = -1 Query: 174 RLMRPLRWTIVS------------VLRQ---PKLTSTVNSTITRNYVSEMRKEAFEANVL 40 RL+R ++ T++S +L+Q +L +TRNY+SEMRK AF+ N+L Sbjct: 3 RLIRTMKRTLISTPKTLIPQLHQQLLQQNPISELKDPFQFVLTRNYISEMRKSAFQDNIL 62 Query: 39 RLIRNEIQYELDR 1 RL+RNEIQYELDR Sbjct: 63 RLLRNEIQYELDR 75 >ref|XP_006465203.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Citrus sinensis] Length = 237 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 LRQPKLTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEIQYELDR 1 L + L + V+ RNY+SEMRK AFE N+LRL+RNEIQYEL+R Sbjct: 29 LFKSNLRNPVSQISKRNYISEMRKSAFEGNILRLLRNEIQYELER 73 >ref|XP_006427587.1| hypothetical protein CICLE_v10026378mg [Citrus clementina] gi|557529577|gb|ESR40827.1| hypothetical protein CICLE_v10026378mg [Citrus clementina] Length = 237 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 LRQPKLTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEIQYELDR 1 L + L + V+ RNY+SEMRK AFE N+LRL+RNEIQYEL+R Sbjct: 29 LFKSNLRNPVSQISKRNYISEMRKSAFEGNILRLLRNEIQYELER 73 >ref|XP_002299266.1| mitochondrial glycoprotein [Populus trichocarpa] gi|222846524|gb|EEE84071.1| mitochondrial glycoprotein [Populus trichocarpa] Length = 251 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 126 PKLTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEIQYELDR 1 P L S +++I RNY+SE RK AF+ N+LRL+RNEIQYELDR Sbjct: 43 PFLISQTHNSIRRNYMSETRKSAFKDNLLRLVRNEIQYELDR 84 >ref|XP_002274018.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial [Vitis vinifera] Length = 239 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 8/65 (12%) Frame = -1 Query: 174 RLMRPLRWTIVS-----VLRQPK---LTSTVNSTITRNYVSEMRKEAFEANVLRLIRNEI 19 R++RPLR ++S + P L S ++ TR+Y+SEMRK AFE N+LRL+R+EI Sbjct: 5 RIIRPLRRALISSSKSVTQKNPNPLHLQSPISIFTTRSYISEMRKSAFEGNILRLLRSEI 64 Query: 18 QYELD 4 +YEL+ Sbjct: 65 EYELE 69