BLASTX nr result
ID: Catharanthus23_contig00039023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00039023 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 38 4e-06 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 38.1 bits (87), Expect(2) = 4e-06 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 7 SINISTQKRSRPRWSV-KIDLEKAYDHFNGEFMEDVLNTLGLEPHLIKLIM 156 +++ +K+ R W + K+DLEKAYD +F+ + L GL IK IM Sbjct: 372 AVHSMRRKKGRKGWMLLKLDLEKAYDRIRWDFLAETLEAAGLSEGWIKRIM 422 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = +3 Query: 177 LSIIWNGEVQEAFIPERRLR*GNALAPY 260 +S++WNGE ++F PER LR G+ ++PY Sbjct: 430 MSLLWNGEKTDSFTPERGLRQGDPISPY 457