BLASTX nr result
ID: Catharanthus23_contig00038331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00038331 (303 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301874.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 >ref|XP_004301874.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 655 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/90 (37%), Positives = 54/90 (60%) Frame = -1 Query: 270 LKYLTVVSRYKAFIFPLQFSYSTTSTFFAGNLRLPLHQILQTLDEKCLYMKEVRQLHAQI 91 LK+ TV+SR +FP + +F N + P+HQ L L E+C M ++QLHAQI Sbjct: 5 LKHPTVISR----LFP-------SHSFHTHNFKTPIHQTLHHLLEQCSSMTHLKQLHAQI 53 Query: 90 IHNGISQHTIALSKLISFYALAKYGDIQYA 1 I + ++ + + KLISF +++ GD++YA Sbjct: 54 ILHRLTSENLTVGKLISFCSVSAAGDLRYA 83