BLASTX nr result
ID: Catharanthus23_contig00038225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00038225 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235709.1| PREDICTED: regulator of telomere elongation ... 124 2e-26 ref|XP_006465547.1| PREDICTED: regulator of telomere elongation ... 116 3e-24 ref|XP_006465546.1| PREDICTED: regulator of telomere elongation ... 116 3e-24 gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1... 114 1e-23 ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 113 3e-23 ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 111 1e-22 ref|XP_006595137.1| PREDICTED: regulator of telomere elongation ... 107 1e-21 gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus... 106 4e-21 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 105 6e-21 ref|XP_003597775.1| Regulator of telomere elongation helicase [M... 105 6e-21 ref|XP_004486727.1| PREDICTED: regulator of telomere elongation ... 103 2e-20 ref|XP_004486726.1| PREDICTED: regulator of telomere elongation ... 103 2e-20 ref|XP_004302912.1| PREDICTED: regulator of telomere elongation ... 100 3e-19 ref|XP_004141849.1| PREDICTED: regulator of telomere elongation ... 100 3e-19 gb|EPS66374.1| hypothetical protein M569_08402, partial [Genlise... 91 2e-16 ref|XP_006842240.1| hypothetical protein AMTR_s00078p00189390 [A... 89 6e-16 emb|CBI36155.3| unnamed protein product [Vitis vinifera] 83 4e-14 ref|XP_004969055.1| PREDICTED: regulator of telomere elongation ... 82 6e-14 ref|XP_006389706.1| hypothetical protein EUTSA_v10018072mg [Eutr... 82 7e-14 ref|NP_001043456.2| Os01g0592900 [Oryza sativa Japonica Group] g... 81 1e-13 >ref|XP_004235709.1| PREDICTED: regulator of telomere elongation helicase 1-like [Solanum lycopersicum] Length = 1036 Score = 124 bits (310), Expect = 2e-26 Identities = 59/85 (69%), Positives = 70/85 (82%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 N E KGSAFLVQVREKLTD+EY +FV +MK+L+SK MKI QVLQSI LFSLPDR LL Sbjct: 950 NNEEKGSAFLVQVREKLTDTEYHEFVGYMKSLKSKAMKIGQVLQSITRLFSLPDRLPLLH 1009 Query: 157 RFKDYIPAKYYTLYEQYVLENQNAS 83 RFKDY+PAKY++LY+QY+ NQ + Sbjct: 1010 RFKDYVPAKYHSLYDQYLKRNQEVA 1034 >ref|XP_006465547.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Citrus sinensis] Length = 1032 Score = 116 bits (291), Expect = 3e-24 Identities = 55/80 (68%), Positives = 69/80 (86%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 EE KGSAFL+QV+EKL+ +EYK+FV FMKA++SK MKIS VLQSIA LF+ P+R LL+R Sbjct: 952 EETKGSAFLIQVQEKLSATEYKEFVGFMKAMKSKAMKISHVLQSIAKLFAGPERLPLLRR 1011 Query: 154 FKDYIPAKYYTLYEQYVLEN 95 FKDY+PAKY+ LYEQY++ N Sbjct: 1012 FKDYVPAKYHPLYEQYLMNN 1031 >ref|XP_006465546.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Citrus sinensis] Length = 1036 Score = 116 bits (291), Expect = 3e-24 Identities = 55/80 (68%), Positives = 69/80 (86%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 EE KGSAFL+QV+EKL+ +EYK+FV FMKA++SK MKIS VLQSIA LF+ P+R LL+R Sbjct: 956 EETKGSAFLIQVQEKLSATEYKEFVGFMKAMKSKAMKISHVLQSIAKLFAGPERLPLLRR 1015 Query: 154 FKDYIPAKYYTLYEQYVLEN 95 FKDY+PAKY+ LYEQY++ N Sbjct: 1016 FKDYVPAKYHPLYEQYLMNN 1035 >gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] Length = 1052 Score = 114 bits (286), Expect = 1e-23 Identities = 54/77 (70%), Positives = 66/77 (85%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 EE KGSAFL+QV+EKL+ +EYK+FV FMKA++SK MKIS VLQSI LFS P+R LL+R Sbjct: 964 EETKGSAFLIQVKEKLSPTEYKEFVGFMKAMKSKVMKISNVLQSIVGLFSGPERLPLLER 1023 Query: 154 FKDYIPAKYYTLYEQYV 104 FKDY+PAKY +LYEQY+ Sbjct: 1024 FKDYVPAKYQSLYEQYI 1040 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 113 bits (282), Expect = 3e-23 Identities = 54/81 (66%), Positives = 69/81 (85%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 +E +GSAFL+QV+EKL+ +EYK+FV FMKAL+SK MKI QVL+SIA LFS P+R LL+R Sbjct: 968 KETRGSAFLIQVQEKLSTAEYKEFVGFMKALKSKAMKIGQVLESIARLFSGPERLPLLKR 1027 Query: 154 FKDYIPAKYYTLYEQYVLENQ 92 FKDYIPAKY +LY+QY+ N+ Sbjct: 1028 FKDYIPAKYQSLYQQYLKNNE 1048 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 111 bits (277), Expect = 1e-22 Identities = 53/78 (67%), Positives = 66/78 (84%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 +EE +GSAFL+QV+EKLT +EYK+FV FMKAL+SK M+I VL+SI LFS PDR LL+ Sbjct: 929 DEEKRGSAFLIQVKEKLTAAEYKEFVGFMKALKSKAMQIGSVLESIVKLFSGPDRFPLLK 988 Query: 157 RFKDYIPAKYYTLYEQYV 104 RFKDYIPAKY++LYE Y+ Sbjct: 989 RFKDYIPAKYHSLYEHYL 1006 >ref|XP_006595137.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Glycine max] Length = 998 Score = 107 bits (268), Expect = 1e-21 Identities = 52/77 (67%), Positives = 66/77 (85%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 +E KGSAFL QVR+KL+ +EY +FV +MKAL++KTMKIS+VLQ I+ LF+ PDR LL+R Sbjct: 919 DETKGSAFLAQVRDKLSAAEYINFVGYMKALKTKTMKISEVLQCISRLFTGPDRLPLLKR 978 Query: 154 FKDYIPAKYYTLYEQYV 104 FKDYIPAKY++LYE YV Sbjct: 979 FKDYIPAKYHSLYEHYV 995 >gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus vulgaris] Length = 971 Score = 106 bits (264), Expect = 4e-21 Identities = 53/79 (67%), Positives = 65/79 (82%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 +E +GSAFL QVR+KL+ +EY DFV MKAL++K MKIS+VLQ I+ LFS PDR LL+R Sbjct: 888 DETQGSAFLAQVRDKLSAAEYIDFVGCMKALKTKAMKISEVLQCISRLFSGPDRLPLLKR 947 Query: 154 FKDYIPAKYYTLYEQYVLE 98 FKDYIPAKY++LYE YV E Sbjct: 948 FKDYIPAKYHSLYEHYVEE 966 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 105 bits (262), Expect = 6e-21 Identities = 51/78 (65%), Positives = 67/78 (85%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 ++ +GSAFL QVR+KL+ +EY DFV +MKAL++KT+KIS+VL SI+ LFS P+R LL+ Sbjct: 990 SDGTQGSAFLAQVRDKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLK 1049 Query: 157 RFKDYIPAKYYTLYEQYV 104 RFKDYIPAKY++LYEQYV Sbjct: 1050 RFKDYIPAKYHSLYEQYV 1067 >ref|XP_003597775.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486823|gb|AES68026.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1048 Score = 105 bits (262), Expect = 6e-21 Identities = 51/78 (65%), Positives = 67/78 (85%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 ++ +GSAFL QVR+KL+ +EY DFV +MKAL++KT+KIS+VL SI+ LFS P+R LL+ Sbjct: 949 SDGTQGSAFLAQVRDKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLK 1008 Query: 157 RFKDYIPAKYYTLYEQYV 104 RFKDYIPAKY++LYEQYV Sbjct: 1009 RFKDYIPAKYHSLYEQYV 1026 >ref|XP_004486727.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Cicer arietinum] Length = 1009 Score = 103 bits (258), Expect = 2e-20 Identities = 51/74 (68%), Positives = 64/74 (86%) Frame = -2 Query: 325 KGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQRFKD 146 +G AFL QVREKL+ +EY DFV +MKAL++KT+KIS+VL SI+ LFS P+R LL+RFKD Sbjct: 931 QGLAFLAQVREKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLKRFKD 990 Query: 145 YIPAKYYTLYEQYV 104 YIPAKY++LYEQYV Sbjct: 991 YIPAKYHSLYEQYV 1004 >ref|XP_004486726.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Cicer arietinum] Length = 1006 Score = 103 bits (258), Expect = 2e-20 Identities = 51/74 (68%), Positives = 64/74 (86%) Frame = -2 Query: 325 KGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQRFKD 146 +G AFL QVREKL+ +EY DFV +MKAL++KT+KIS+VL SI+ LFS P+R LL+RFKD Sbjct: 928 QGLAFLAQVREKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLKRFKD 987 Query: 145 YIPAKYYTLYEQYV 104 YIPAKY++LYEQYV Sbjct: 988 YIPAKYHSLYEQYV 1001 >ref|XP_004302912.1| PREDICTED: regulator of telomere elongation helicase 1-like [Fragaria vesca subsp. vesca] Length = 1045 Score = 99.8 bits (247), Expect = 3e-19 Identities = 48/86 (55%), Positives = 67/86 (77%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 +EE +GS FL+QV+EKL+ EYK+FV+ MKAL+SK M IS+VLQSIA LF P+R LL+ Sbjct: 950 DEETRGSQFLIQVKEKLSALEYKEFVNLMKALKSKAMNISEVLQSIARLFCGPERLPLLK 1009 Query: 157 RFKDYIPAKYYTLYEQYVLENQNASA 80 RFK +IPAKY+++Y+ Y N ++ + Sbjct: 1010 RFKYFIPAKYHSMYDHYFQTNGSSQS 1035 >ref|XP_004141849.1| PREDICTED: regulator of telomere elongation helicase 1-like [Cucumis sativus] Length = 1054 Score = 99.8 bits (247), Expect = 3e-19 Identities = 51/76 (67%), Positives = 59/76 (77%) Frame = -2 Query: 337 NEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQ 158 +EE KGS FL QVREKL+D EYK+FV FMKAL++K M I+ VLQSI +FS PDR L Sbjct: 973 DEEAKGSDFLSQVREKLSDREYKEFVGFMKALKTKAMGITHVLQSIVRIFSGPDRLRLRT 1032 Query: 157 RFKDYIPAKYYTLYEQ 110 FKDYIPAKY+ LYEQ Sbjct: 1033 GFKDYIPAKYHFLYEQ 1048 >gb|EPS66374.1| hypothetical protein M569_08402, partial [Genlisea aurea] Length = 538 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/75 (54%), Positives = 58/75 (77%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 +E KGSAFL QVREKL++ EY+ FV +++AL+SK M+I +VL+SI LFS P R LL Sbjct: 462 DEMKGSAFLSQVREKLSEDEYRKFVEYLRALKSKEMRIGEVLESITRLFSTPQRHHLLHG 521 Query: 154 FKDYIPAKYYTLYEQ 110 F+D++PAKY +Y++ Sbjct: 522 FRDFVPAKYREMYDR 536 >ref|XP_006842240.1| hypothetical protein AMTR_s00078p00189390 [Amborella trichopoda] gi|548844289|gb|ERN03915.1| hypothetical protein AMTR_s00078p00189390 [Amborella trichopoda] Length = 1133 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/79 (51%), Positives = 59/79 (74%) Frame = -2 Query: 340 DNEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLL 161 D + K S FL Q + KL+ +EYK FV FM+AL++KTM +S +L+S+A +FS P+R LL Sbjct: 1004 DEKTTKASDFLKQAQLKLSGAEYKKFVEFMRALKAKTMNMSSLLESVAEMFSSPERLFLL 1063 Query: 160 QRFKDYIPAKYYTLYEQYV 104 +RFKDY+PA Y LYE+++ Sbjct: 1064 KRFKDYVPANYLPLYEKHL 1082 >emb|CBI36155.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/62 (64%), Positives = 53/62 (85%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 +E +GSAFL+QV+EKL+ +EYK+FV FMKAL+SK MKI QVL+SIA LFS P+R LL+R Sbjct: 268 KETRGSAFLIQVQEKLSTAEYKEFVGFMKALKSKAMKIGQVLESIARLFSGPERLPLLKR 327 Query: 154 FK 149 ++ Sbjct: 328 YE 329 >ref|XP_004969055.1| PREDICTED: regulator of telomere elongation helicase 1-like [Setaria italica] Length = 1024 Score = 82.4 bits (202), Expect = 6e-14 Identities = 43/85 (50%), Positives = 56/85 (65%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 E N G+AFL REKL+ +EYK+FV FMKAL+ KTM I L++IA LFS P R LL+ Sbjct: 940 ESNSGTAFLRLAREKLSGAEYKEFVEFMKALKLKTMHIKDSLEAIAKLFSSPGRLPLLEG 999 Query: 154 FKDYIPAKYYTLYEQYVLENQNASA 80 F+ ++P + LYEQ V + SA Sbjct: 1000 FRVFVPKNHLPLYEQLVQKYSVCSA 1024 >ref|XP_006389706.1| hypothetical protein EUTSA_v10018072mg [Eutrema salsugineum] gi|557086140|gb|ESQ26992.1| hypothetical protein EUTSA_v10018072mg [Eutrema salsugineum] Length = 986 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/80 (47%), Positives = 54/80 (67%) Frame = -2 Query: 340 DNEENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLL 161 DN+E SAFL QV+EKL EY F+ +M+AL+ K +K++ V+QSI LF +R LL Sbjct: 901 DNKEASASAFLSQVKEKLNTEEYNKFIGYMQALKKKELKLANVIQSIVQLFCGTERDHLL 960 Query: 160 QRFKDYIPAKYYTLYEQYVL 101 F+D++PAKY YEQ ++ Sbjct: 961 MGFRDFVPAKYRPAYEQCII 980 >ref|NP_001043456.2| Os01g0592900 [Oryza sativa Japonica Group] gi|53791584|dbj|BAD52706.1| DEAH helicase isoform 5-like [Oryza sativa Japonica Group] gi|255673416|dbj|BAF05370.2| Os01g0592900 [Oryza sativa Japonica Group] Length = 876 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/77 (51%), Positives = 53/77 (68%) Frame = -2 Query: 334 EENKGSAFLVQVREKLTDSEYKDFVSFMKALRSKTMKISQVLQSIASLFSLPDRRSLLQR 155 E N G AFL REKL+ +EY+DFV +MKAL+ KTM I L +IA LFS P+R LL+ Sbjct: 792 ESNAGPAFLKLAREKLSTAEYRDFVEYMKALKLKTMHIKDSLDAIAKLFSSPERLPLLEG 851 Query: 154 FKDYIPAKYYTLYEQYV 104 F+ ++P + +LYEQ V Sbjct: 852 FRVFVPKNHLSLYEQLV 868