BLASTX nr result
ID: Catharanthus23_contig00038100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00038100 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 42 6e-06 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 42.0 bits (97), Expect(2) = 6e-06 Identities = 20/40 (50%), Positives = 26/40 (65%) Frame = +2 Query: 119 SVRART*FFSDVSKSSEYIPCDICFRAKQTQEMFPISLNK 238 SV + FS S + CD+CFRAKQT+E+FP S+NK Sbjct: 540 SVLSSLPLFSKTSSTVTSHSCDVCFRAKQTREVFPESINK 579 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 48 VVPAKINKMTSNASRKLWHQRLSHP 122 V PAKI+ ++ + LWHQRL HP Sbjct: 513 VTPAKIHTANVDSDQALWHQRLGHP 537