BLASTX nr result
ID: Catharanthus23_contig00038043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00038043 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI18282.1| hypothetical protein [uncultured Chromatiales bac... 77 3e-12 ref|WP_005514638.1| hypothetical protein [Vibrio mimicus] gi|258... 63 5e-08 >gb|ADI18282.1| hypothetical protein [uncultured Chromatiales bacterium HF0200_41F04] Length = 89 Score = 76.6 bits (187), Expect = 3e-12 Identities = 47/82 (57%), Positives = 50/82 (60%), Gaps = 2/82 (2%) Frame = -2 Query: 267 VLSNALGYSPRPPVSVWGTDSFCLKLRDFSWKHGINHFVSKE-TRHHASDNHSG-FA*SA 94 VLS+ALGYSP PPVSVWGT +F LKLR FSWK GINHF K+ RH S S F Sbjct: 8 VLSSALGYSPCPPVSVWGTVTFYLKLRGFSWKQGINHFGPKKGPRHRISGLLSRIFLREL 67 Query: 93 LLCA*TTIQQVAGLTFSVLPSQ 28 C A LTFSV PSQ Sbjct: 68 PTCLNRDNHHPADLTFSVTPSQ 89 >ref|WP_005514638.1| hypothetical protein [Vibrio mimicus] gi|258583990|gb|EEW08769.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573] Length = 104 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 267 VLSNALGYSPRPPVSVWGTDSFCLKLRDFSWKHGINHFVSKETRHHAS 124 VLS+AL +S RPPVSVWGT + LKLR FSWKHGIN F + R S Sbjct: 49 VLSSALVFSTRPPVSVWGTIPYNLKLRGFSWKHGINDFTTVVARRRVS 96