BLASTX nr result
ID: Catharanthus23_contig00037458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00037458 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006597223.1| PREDICTED: uncharacterized protein LOC102668... 59 9e-07 ref|XP_002309795.1| hypothetical protein POPTR_0007s01810g [Popu... 56 6e-06 >ref|XP_006597223.1| PREDICTED: uncharacterized protein LOC102668409 [Glycine max] Length = 123 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 4/81 (4%) Frame = -1 Query: 334 EYLQARRAFLSSYQFSHEHK---SLNEKLKQSAKGIGKLAVEIFLQFREEISKKWVRFRV 164 E+ +ARRAFL+SY S E K S EKLK+S K + + A+ + L R +SK+ V +V Sbjct: 36 EFCEARRAFLNSYHLSLERKNNVSFKEKLKKSVKEVNEAAMGVVLGMRRGVSKRRVGIKV 95 Query: 163 YKFKIGWPTGVF-SMRCFVTW 104 ++ K+ + V ++RCF+ W Sbjct: 96 FRVKMSSHSMVLVTLRCFIPW 116 >ref|XP_002309795.1| hypothetical protein POPTR_0007s01810g [Populus trichocarpa] gi|222852698|gb|EEE90245.1| hypothetical protein POPTR_0007s01810g [Populus trichocarpa] Length = 135 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/69 (42%), Positives = 43/69 (62%) Frame = -1 Query: 331 YLQARRAFLSSYQFSHEHKSLNEKLKQSAKGIGKLAVEIFLQFREEISKKWVRFRVYKFK 152 Y ARRAFLSSY FS E+ + +KL++S K I ++ + REEI K+ +R +V +F Sbjct: 38 YRNARRAFLSSYHFSEEN-GIRDKLRRSVKEINEVVRGVVSDIREEICKRRIRIKVCRFS 96 Query: 151 IGWPTGVFS 125 +G P + S Sbjct: 97 LGLPCLILS 105