BLASTX nr result
ID: Catharanthus23_contig00037274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00037274 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB57572.1| hypothetical protein L484_022679 [Morus notabilis] 74 2e-11 gb|ESW17062.1| hypothetical protein PHAVU_007G206900g [Phaseolus... 70 2e-10 ref|NP_001237038.1| uncharacterized protein LOC100500628 [Glycin... 67 3e-09 ref|XP_006423943.1| hypothetical protein CICLE_v10029949mg [Citr... 66 5e-09 gb|EMJ08848.1| hypothetical protein PRUPE_ppa021432mg [Prunus pe... 62 1e-07 ref|XP_002512598.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_003591277.1| hypothetical protein MTR_1g085190 [Medicago ... 57 3e-06 >gb|EXB57572.1| hypothetical protein L484_022679 [Morus notabilis] Length = 104 Score = 73.9 bits (180), Expect = 2e-11 Identities = 42/82 (51%), Positives = 52/82 (63%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPEIINDQENGILTKHHRYMSN 182 KMW VPCT+R+ +LRT+S DIEEILK KL TIKEEPEI + + K ++ Sbjct: 7 KMWRAVPCTSRK---SLRTDSWKDIEEILKSKLATIKEEPEICEENQTSPRLKR---LAK 60 Query: 183 KMKKIHLKVKMGRLLMPQFSLK 248 K K K K+G L+PQFSLK Sbjct: 61 KGKNTRSKDKVGNFLLPQFSLK 82 >gb|ESW17062.1| hypothetical protein PHAVU_007G206900g [Phaseolus vulgaris] Length = 101 Score = 70.5 bits (171), Expect = 2e-10 Identities = 40/82 (48%), Positives = 52/82 (63%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPEIINDQENGILTKHHRYMSN 182 K+W VPCT+R+ LRTESR D+EEIL+ KL TIKEEPE+ +EN +H R Sbjct: 7 KIWRSVPCTSRKC---LRTESRKDMEEILRAKLSTIKEEPELC--EENLTSPRHMRMAKK 61 Query: 183 KMKKIHLKVKMGRLLMPQFSLK 248 + KK+ K K R L+P +LK Sbjct: 62 QGKKVQAKDKSARCLVPHVNLK 83 >ref|NP_001237038.1| uncharacterized protein LOC100500628 [Glycine max] gi|255630788|gb|ACU15755.1| unknown [Glycine max] Length = 105 Score = 66.6 bits (161), Expect = 3e-09 Identities = 38/83 (45%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPEIINDQENGILTKHHRYMSN 182 K+W VPCT+R+ +LR +SR D+EEIL+ KL TIKEEPE+ ++ + + H M+ Sbjct: 7 KIWRSVPCTSRK---SLRNDSRKDMEEILRAKLSTIKEEPELCDE---NLASPRHVCMAK 60 Query: 183 KM-KKIHLKVKMGRLLMPQFSLK 248 K KK+ K K GR L+P +LK Sbjct: 61 KQGKKVQGKDKTGRCLVPHVNLK 83 >ref|XP_006423943.1| hypothetical protein CICLE_v10029949mg [Citrus clementina] gi|557525877|gb|ESR37183.1| hypothetical protein CICLE_v10029949mg [Citrus clementina] Length = 95 Score = 65.9 bits (159), Expect = 5e-09 Identities = 44/87 (50%), Positives = 50/87 (57%), Gaps = 5/87 (5%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTN-LRTESRMDIEEILKMKLETIKEEPEIINDQENGILTK---HHR 170 KMWWVVPCT K + LRTES IE+ILK KL TIKEEP + +E LT Sbjct: 5 KMWWVVPCTNMSGKRSCLRTESMKSIEDILKTKLATIKEEP---SAEEYSCLTPSTLRRL 61 Query: 171 YMSNKMKKIHLKVKMGRLLMPQF-SLK 248 +K K K KM RL +PQF SLK Sbjct: 62 AKKDKGKIFRSKAKMARLFLPQFISLK 88 >gb|EMJ08848.1| hypothetical protein PRUPE_ppa021432mg [Prunus persica] Length = 97 Score = 61.6 bits (148), Expect = 1e-07 Identities = 41/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPEIINDQENGILTKHHRY--M 176 KMW VVPC +R+ N RT+S DIEEILK KL TIKEEPE + LT R + Sbjct: 7 KMWRVVPCMSRK---NFRTDSWKDIEEILKSKLATIKEEPETCEES----LTPPPRLWRL 59 Query: 177 SNKMKKIHLKVKMGRLLMPQFSLK 248 + K +K+ K LMP FSLK Sbjct: 60 AKKGQKMGSKDIRRHFLMPNFSLK 83 >ref|XP_002512598.1| conserved hypothetical protein [Ricinus communis] gi|223548559|gb|EEF50050.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +3 Query: 3 KMWWVVPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPE 125 +MW VVPCT+ KT LRTESR DIEEILK KL TIKEEPE Sbjct: 7 RMWRVVPCTS---KTILRTESRKDIEEILKTKLATIKEEPE 44 >ref|XP_003591277.1| hypothetical protein MTR_1g085190 [Medicago truncatula] gi|355480325|gb|AES61528.1| hypothetical protein MTR_1g085190 [Medicago truncatula] gi|388491842|gb|AFK33987.1| unknown [Medicago truncatula] Length = 100 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/77 (46%), Positives = 44/77 (57%) Frame = +3 Query: 18 VPCTTRRRKTNLRTESRMDIEEILKMKLETIKEEPEIINDQENGILTKHHRYMSNKMKKI 197 VPCT+RR ESR D+EEIL+ KL TI EEPE+ + LT R+M KK Sbjct: 12 VPCTSRRN------ESRKDMEEILRAKLSTIIEEPELCEEN----LTSPPRHMMRISKKQ 61 Query: 198 HLKVKMGRLLMPQFSLK 248 K K GR L+P +LK Sbjct: 62 GKKNKAGRCLVPHVNLK 78