BLASTX nr result
ID: Catharanthus23_contig00036854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00036854 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305796.1| PREDICTED: U-box domain-containing protein 3... 66 5e-09 ref|XP_004163060.1| PREDICTED: U-box domain-containing protein 3... 66 5e-09 ref|XP_004152889.1| PREDICTED: U-box domain-containing protein 3... 66 5e-09 ref|XP_006468244.1| PREDICTED: U-box domain-containing protein 3... 65 9e-09 ref|XP_006450025.1| hypothetical protein CICLE_v10013950mg [Citr... 65 9e-09 gb|EOY32181.1| Kinase protein with adenine nucleotide alpha hydr... 65 9e-09 gb|EOY32180.1| Kinase protein with adenine nucleotide alpha hydr... 65 9e-09 ref|XP_002518240.1| ATP binding protein, putative [Ricinus commu... 65 9e-09 ref|XP_006580498.1| PREDICTED: U-box domain-containing protein 3... 65 1e-08 ref|XP_006580497.1| PREDICTED: U-box domain-containing protein 3... 65 1e-08 gb|EOY29080.1| Kinase protein with adenine nucleotide alpha hydr... 65 1e-08 gb|EMJ27969.1| hypothetical protein PRUPE_ppa018572mg [Prunus pe... 65 1e-08 ref|XP_003631778.1| PREDICTED: U-box domain-containing protein 3... 65 1e-08 emb|CBI20806.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002513301.1| ATP binding protein, putative [Ricinus commu... 65 1e-08 emb|CAN69465.1| hypothetical protein VITISV_023046 [Vitis vinifera] 65 1e-08 gb|ESW32211.1| hypothetical protein PHAVU_002G302700g [Phaseolus... 64 2e-08 ref|XP_006296408.1| hypothetical protein CARUB_v10025585mg [Caps... 64 2e-08 ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata] gi... 64 2e-08 ref|NP_180014.2| adenine nucleotide alpha hydrolase domain-conta... 64 2e-08 >ref|XP_004305796.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria vesca subsp. vesca] Length = 766 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 DEVEAEMRRLK ELKQTMDMYSTAC+EALTAKQK Sbjct: 333 DEVEAEMRRLKLELKQTMDMYSTACREALTAKQK 366 >ref|XP_004163060.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus] Length = 887 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D+VEAEMRRLK ELKQTMDMYSTACKEALTAKQK Sbjct: 420 DDVEAEMRRLKLELKQTMDMYSTACKEALTAKQK 453 >ref|XP_004152889.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus] Length = 860 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D+VEAEMRRLK ELKQTMDMYSTACKEALTAKQK Sbjct: 393 DDVEAEMRRLKLELKQTMDMYSTACKEALTAKQK 426 >ref|XP_006468244.1| PREDICTED: U-box domain-containing protein 35-like [Citrus sinensis] Length = 775 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 DEVEAEMRRLK ELKQTMDMYSTACKEAL AKQK Sbjct: 313 DEVEAEMRRLKLELKQTMDMYSTACKEALVAKQK 346 >ref|XP_006450025.1| hypothetical protein CICLE_v10013950mg [Citrus clementina] gi|557553250|gb|ESR63265.1| hypothetical protein CICLE_v10013950mg [Citrus clementina] Length = 731 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 DEVEAEMRRLK ELKQTMDMYSTACKEAL AKQK Sbjct: 300 DEVEAEMRRLKLELKQTMDMYSTACKEALVAKQK 333 >gb|EOY32181.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 2 [Theobroma cacao] Length = 563 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 D+VEAEMRRL+QELKQTMDMYS ACKEALTAKQ+ + Sbjct: 104 DDVEAEMRRLRQELKQTMDMYSAACKEALTAKQRAK 139 >gb|EOY32180.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 1 [Theobroma cacao] Length = 799 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 D+VEAEMRRL+QELKQTMDMYS ACKEALTAKQ+ + Sbjct: 340 DDVEAEMRRLRQELKQTMDMYSAACKEALTAKQRAK 375 >ref|XP_002518240.1| ATP binding protein, putative [Ricinus communis] gi|223542587|gb|EEF44126.1| ATP binding protein, putative [Ricinus communis] Length = 802 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 D+VEAEMRRLK ELKQTM+MYSTACKEALTAK+K R Sbjct: 352 DDVEAEMRRLKLELKQTMEMYSTACKEALTAKEKTR 387 >ref|XP_006580498.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 [Glycine max] Length = 789 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 147 TKLKKYLYNV*DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 T + +++ DEVEAEMRRLK ELKQTM++YS+ACKEA+TAKQK Sbjct: 321 TSMSSSMFSASDEVEAEMRRLKLELKQTMELYSSACKEAMTAKQK 365 >ref|XP_006580497.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 [Glycine max] Length = 808 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 147 TKLKKYLYNV*DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 T + +++ DEVEAEMRRLK ELKQTM++YS+ACKEA+TAKQK Sbjct: 340 TSMSSSMFSASDEVEAEMRRLKLELKQTMELYSSACKEAMTAKQK 384 >gb|EOY29080.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain [Theobroma cacao] Length = 765 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 D+VEAEMRRLK ELKQTM+MYS+ACKEALTAKQK R Sbjct: 314 DDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKAR 349 >gb|EMJ27969.1| hypothetical protein PRUPE_ppa018572mg [Prunus persica] Length = 762 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 DE+EAEMRRL+ ELKQTMDMYSTACKEALTAKQK Sbjct: 304 DEMEAEMRRLRLELKQTMDMYSTACKEALTAKQK 337 >ref|XP_003631778.1| PREDICTED: U-box domain-containing protein 35-like [Vitis vinifera] Length = 796 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 ++VEAEMRRLK ELKQTMDMYSTACKEAL+AKQK R Sbjct: 333 EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKAR 368 >emb|CBI20806.3| unnamed protein product [Vitis vinifera] Length = 1126 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 ++VEAEMRRLK ELKQTMDMYSTACKEAL+AKQK R Sbjct: 738 EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKAR 773 >ref|XP_002513301.1| ATP binding protein, putative [Ricinus communis] gi|223547209|gb|EEF48704.1| ATP binding protein, putative [Ricinus communis] Length = 786 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D++EAEMRRLK ELKQTMDMYSTACKEALTAKQK Sbjct: 321 DDMEAEMRRLKLELKQTMDMYSTACKEALTAKQK 354 >emb|CAN69465.1| hypothetical protein VITISV_023046 [Vitis vinifera] Length = 768 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQKVR 7 ++VEAEMRRLK ELKQTMDMYSTACKEAL+AKQK R Sbjct: 305 EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKAR 340 >gb|ESW32211.1| hypothetical protein PHAVU_002G302700g [Phaseolus vulgaris] Length = 778 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 129 LYNV*DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 +++ D+VEAEMRRLK ELKQTM+MYSTACKEA+TAKQK Sbjct: 322 MFSAQDDVEAEMRRLKLELKQTMEMYSTACKEAMTAKQK 360 >ref|XP_006296408.1| hypothetical protein CARUB_v10025585mg [Capsella rubella] gi|482565116|gb|EOA29306.1| hypothetical protein CARUB_v10025585mg [Capsella rubella] Length = 806 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D+VEAEMRRLK ELKQTM+MYSTACKEALTAKQK Sbjct: 369 DDVEAEMRRLKLELKQTMEMYSTACKEALTAKQK 402 >ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata] gi|297326417|gb|EFH56837.1| kinase [Arabidopsis lyrata subsp. lyrata] Length = 788 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D+VEAEMRRLK ELKQTM+MYSTACKEALTAKQK Sbjct: 347 DDVEAEMRRLKLELKQTMEMYSTACKEALTAKQK 380 >ref|NP_180014.2| adenine nucleotide alpha hydrolase domain-containing protein kinase [Arabidopsis thaliana] gi|91806264|gb|ABE65860.1| protein kinase family protein [Arabidopsis thaliana] gi|330252473|gb|AEC07567.1| adenine nucleotide alpha hydrolase domain-containing protein kinase [Arabidopsis thaliana] Length = 788 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 114 DEVEAEMRRLKQELKQTMDMYSTACKEALTAKQK 13 D+VEAEMRRLK ELKQTM+MYSTACKEALTAKQK Sbjct: 347 DDVEAEMRRLKLELKQTMEMYSTACKEALTAKQK 380