BLASTX nr result
ID: Catharanthus23_contig00036561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00036561 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510409.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002510409.1| conserved hypothetical protein [Ricinus communis] gi|223551110|gb|EEF52596.1| conserved hypothetical protein [Ricinus communis] Length = 97 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +2 Query: 137 MSERTFVVILFFWAVLTIITPTLVRLSASAKPHY 238 M+ERTF+VI FFWA+LTI+TPTL+ LS S+KP + Sbjct: 1 MTERTFIVIFFFWAILTIVTPTLILLSESSKPDW 34