BLASTX nr result
ID: Catharanthus23_contig00035818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00035818 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 3e-06 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 52/158 (32%), Positives = 69/158 (43%), Gaps = 12/158 (7%) Frame = +1 Query: 1 IRERIDRVWCNWK*HEKFRSDAVHHLLRVHSDHHPLLIKCEPPLSRPTFP--CYMVTTFH 174 I+ER+DR N + + F V HL R SDH PLLI +FP C V +H Sbjct: 194 IKERLDRALVNSEWLDLFPDTKVIHLPRTFSDHCPLLILFNENPRSESFPFRCKEVWAYH 253 Query: 175 V**VIT*CREGRIERIWPYN*GIYHA----------S*IHWCLGILDLEKRGFLALLDGI 324 IE W + Y A S + G + +K+ LA L GI Sbjct: 254 P------DFTNVIEETWGSHHNSYVAARDLFLSSVKSWSKYVFGSIFQKKKRILARLGGI 307 Query: 325 KKRSTADESEFLDHLEGKLIHEYNKIL*QEELFWWQKA 438 +K + S FL LE L+ E N++ QE +FW QKA Sbjct: 308 QKSLSIHPSVFLSKLEIDLLVELNELSKQERVFWAQKA 345