BLASTX nr result
ID: Catharanthus23_contig00035779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00035779 (596 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61812.1| hypothetical protein L484_012245 [Morus notabilis] 81 2e-13 ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp.... 63 5e-08 ref|YP_008992271.1| hypothetical protein Salmi_Mp005 (mitochondr... 60 3e-07 dbj|BAG84633.1| hypothetical protein [Aegilops crassa] 60 3e-07 >gb|EXB61812.1| hypothetical protein L484_012245 [Morus notabilis] Length = 80 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 473 SLSSVFLVLENGRHLSQDRNDYPCPMGLHPSLNIVGYC*LP 595 SLSSVFLVLENGR+LSQD NDYPCPMGLHPSLN+VGYC LP Sbjct: 32 SLSSVFLVLENGRNLSQDWNDYPCPMGLHPSLNVVGYCSLP 72 >ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp. mays] gi|40795108|gb|AAR91152.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954228|gb|AFW86877.1| putative uncharacterized protein orf110-c [Zea mays] gi|413954267|gb|AFW86916.1| putative uncharacterized protein orf110-c [Zea mays] Length = 110 Score = 63.2 bits (152), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 596 GEVNSTRRYSGMDVDPSGRDNHSGPGRGGDHS 501 GEV STRR+SGM+VDPSGRDNHSGPGRGGD S Sbjct: 77 GEVKSTRRHSGMNVDPSGRDNHSGPGRGGDTS 108 >ref|YP_008992271.1| hypothetical protein Salmi_Mp005 (mitochondrion) [Salvia miltiorrhiza] gi|534292250|gb|AGU16542.1| hypothetical protein Salmi_Mp005 (mitochondrion) [Salvia miltiorrhiza] Length = 117 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 596 GEVNSTRRYSGMDVDPSGRDNHSGPGRGGDHSQEPK 489 GEVNSTRR+SGMDVDPSGRDNHSGPGR S+ K Sbjct: 75 GEVNSTRRHSGMDVDPSGRDNHSGPGRWRPFSRTKK 110 >dbj|BAG84633.1| hypothetical protein [Aegilops crassa] Length = 113 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 596 GEVNSTRRYSGMDVDPSGRDNHSGPGRGGDHS 501 GEV STRR+SGM+VDPSG DNHSGPGRGGD S Sbjct: 80 GEVKSTRRHSGMNVDPSGGDNHSGPGRGGDTS 111