BLASTX nr result
ID: Catharanthus23_contig00035709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00035709 (385 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 50 4e-10 ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago ... 66 6e-09 ref|XP_003589969.1| hypothetical protein MTR_1g042380 [Medicago ... 62 8e-08 gb|ESW12257.1| hypothetical protein PHAVU_008G097400g [Phaseolus... 61 2e-07 ref|XP_003617239.1| hypothetical protein MTR_5g089380 [Medicago ... 60 2e-07 gb|ESW03809.1| hypothetical protein PHAVU_011G043800g, partial [... 59 5e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002324578.1| predicted protein [Populus trichocarpa] 55 7e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 50.1 bits (118), Expect(2) = 4e-10 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +1 Query: 142 RHRSVIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA 255 RH+ VI PL RAG RCSVKPASR A RSR++ T AFA Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFA 53 Score = 39.7 bits (91), Expect(2) = 4e-10 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +3 Query: 261 HVAQLSAWSGRRSSRALADLPAGLDQSPIISKPPLGSQAH 380 H+AQLSAW+GR ++ P G +Q PI P L QAH Sbjct: 56 HIAQLSAWNGRARAQPHQGRPTGPEQRPITLMPLLRLQAH 95 >ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago truncatula] gi|355518312|gb|AES99935.1| hypothetical protein MTR_5g086360 [Medicago truncatula] Length = 81 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/64 (53%), Positives = 39/64 (60%) Frame = +1 Query: 154 VIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA*VTWPNSPLGAGGAAVAH*QTYPLGW 333 VIPPL RA RCS KPASR A SR++ET+AFA + WPNS LG G Q P Sbjct: 16 VIPPLSRARGLRCSAKPASRSALSSRNQETKAFAQIPWPNSQLGEGKPTYCRNQPSPTSH 75 Query: 334 TKVP 345 + VP Sbjct: 76 SHVP 79 >ref|XP_003589969.1| hypothetical protein MTR_1g042380 [Medicago truncatula] gi|355479017|gb|AES60220.1| hypothetical protein MTR_1g042380 [Medicago truncatula] Length = 213 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/60 (51%), Positives = 36/60 (60%) Frame = +2 Query: 206 PHALPTALETVRPKPSPKSRGPTLRLERAAQQSRTSRLTRWAGPKSHHLKASTWITSPRY 385 PHA+P L T R +PSP SRG TL LERA Q +R + A HH A TW+TS RY Sbjct: 113 PHAIPPRLGTKRHRPSPMSRGKTLNLERAGQHIAANRPAKQAVATFHHFGAPTWVTSWRY 172 >gb|ESW12257.1| hypothetical protein PHAVU_008G097400g [Phaseolus vulgaris] Length = 61 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/49 (65%), Positives = 34/49 (69%) Frame = +1 Query: 154 VIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA*VTWPNSPLGAGGAA 300 VIPPL GSFRCSV PASR A R++ETQAFA V W NS LG G A Sbjct: 5 VIPPLSGEGSFRCSVNPASRCALHFRNQETQAFAQVPWFNSQLGVGRPA 53 >ref|XP_003617239.1| hypothetical protein MTR_5g089380 [Medicago truncatula] gi|355518574|gb|AET00198.1| hypothetical protein MTR_5g089380 [Medicago truncatula] Length = 68 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 154 VIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA*VTWPNSPLGAGGAA 300 VIPPL R GS CSVKPAS + SRD+E AFA + WPNS LGAG A Sbjct: 20 VIPPLSREGSVHCSVKPASCGSLHSRDQEICAFAKIPWPNSQLGAGRPA 68 >gb|ESW03809.1| hypothetical protein PHAVU_011G043800g, partial [Phaseolus vulgaris] Length = 70 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/51 (62%), Positives = 34/51 (66%) Frame = +1 Query: 154 VIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA*VTWPNSPLGAGGAAVA 306 VIPPL RA RCSVKPASR A SR++ET AFA W NS LG G A A Sbjct: 13 VIPPLSRARGSRCSVKPASRIALSSRNQETNAFAMFPWLNSQLGVGKPADA 63 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = -2 Query: 291 ARSKRRVGPRDLGEGLGLTVSRAVGKA*GWFHRAAKTTRSLQWRDNGSV 145 ARSK RV P LGEG G RA G A GWFHRAA T+ S QW+DNG V Sbjct: 5 ARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >ref|XP_002324578.1| predicted protein [Populus trichocarpa] Length = 84 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +1 Query: 145 HRSVIPPLQRAGSFRCSVKPASRFAHRSRDRETQAFA*VTWPNSPLGAGGA 297 HR VI PL AG RCSV+PASR A SR + TQ F + W NS LG GG+ Sbjct: 16 HRPVILPLPGAGGDRCSVRPASRCALPSRSQNTQVFTRMPWLNSWLGTGGS 66