BLASTX nr result
ID: Catharanthus23_contig00035206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00035206 (237 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277434.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] 58 1e-06 emb|CBI38550.3| unnamed protein product [Vitis vinifera] 58 1e-06 >ref|XP_002277434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Vitis vinifera] Length = 835 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 235 RRLFIEMNEKGFIPRKTTLSFISSAVAKAGKMDDAQTWLEKLYKKKS 95 +RLF EMNEKGFIP + TL+ IS +AK GK DAQ L KLYKKK+ Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKKT 794 >emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] Length = 882 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 235 RRLFIEMNEKGFIPRKTTLSFISSAVAKAGKMDDAQTWLEKLYKKKS 95 +RLF EMNEKGFIP + TL+ IS +AK GK DAQ L KLYKKK+ Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKKT 794 >emb|CBI38550.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 235 RRLFIEMNEKGFIPRKTTLSFISSAVAKAGKMDDAQTWLEKLYKKK 98 +RLF EMNEKGFIP + TL+ IS +AK GK DAQ L KLYKKK Sbjct: 748 KRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYKKK 793