BLASTX nr result
ID: Catharanthus23_contig00034962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00034962 (242 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006297059.1| hypothetical protein CARUB_v10013060mg [Caps... 58 1e-06 ref|NP_188975.3| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 ref|XP_002883423.1| pentatricopeptide repeat-containing protein ... 56 4e-06 >ref|XP_006297059.1| hypothetical protein CARUB_v10013060mg [Capsella rubella] gi|482565768|gb|EOA29957.1| hypothetical protein CARUB_v10013060mg [Capsella rubella] Length = 730 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 241 GESLHGSIIRLGFDCDLYTGNALMTMYAKL 152 GES+HG I+RLG DCDLYTGNALM MYAKL Sbjct: 124 GESVHGCIVRLGMDCDLYTGNALMNMYAKL 153 >ref|NP_188975.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274454|sp|Q9LW63.1|PP251_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g23330 gi|11994318|dbj|BAB02277.1| unnamed protein product [Arabidopsis thaliana] gi|332643232|gb|AEE76753.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 715 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 241 GESLHGSIIRLGFDCDLYTGNALMTMYAKL 152 GES+HG I+RLG DCDLYTGNALM MYAKL Sbjct: 124 GESVHGFIVRLGMDCDLYTGNALMNMYAKL 153 >ref|XP_002883423.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329263|gb|EFH59682.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 679 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 241 GESLHGSIIRLGFDCDLYTGNALMTMYAKL 152 GES+HG I+RLG DCDLYTGNALM MY+KL Sbjct: 124 GESVHGFIVRLGMDCDLYTGNALMNMYSKL 153