BLASTX nr result
ID: Catharanthus23_contig00034908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00034908 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526353.1| nutrient reservoir, putative [Ricinus commun... 56 6e-06 >ref|XP_002526353.1| nutrient reservoir, putative [Ricinus communis] gi|223534312|gb|EEF36024.1| nutrient reservoir, putative [Ricinus communis] Length = 463 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 309 DWFLLKDSMHVIKSDAGDMRVVRGGGKRLWRSPMHI 416 DWFLL+DS HV+K+DAGDMRVV+ G R+ PMHI Sbjct: 46 DWFLLQDSKHVVKTDAGDMRVVKNFGGRILERPMHI 81