BLASTX nr result
ID: Catharanthus23_contig00034761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00034761 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25387.1| hypothetical protein PRUPE_ppa016658mg, partial [... 52 8e-06 >gb|EMJ25387.1| hypothetical protein PRUPE_ppa016658mg, partial [Prunus persica] Length = 495 Score = 52.4 bits (124), Expect(2) = 8e-06 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = +1 Query: 58 GPWIIMGNYVTVLKWRQNFCPEGETITSTLVWLRFPRLHLELFD 189 GPWI+ G Y+ + KWR FCP IT WLR + LE FD Sbjct: 170 GPWIVAGQYLVMQKWRPGFCPATAHITRMAAWLRVSAIQLECFD 213 Score = 22.7 bits (47), Expect(2) = 8e-06 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +2 Query: 182 SSMKMGNAVGRAIRVGATTMAANRVE 259 S ++GN + + +++ + T A NRV+ Sbjct: 216 SLKRIGNMLSKLLKIDSLTTAQNRVD 241