BLASTX nr result
ID: Catharanthus23_contig00033918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00033918 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234421.1| CHI protein [Solanum lycopersicum] gi|338676... 64 2e-08 ref|XP_002521478.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 gb|EXC20353.1| hypothetical protein L484_020574 [Morus notabilis] 60 3e-07 gb|AHB32112.1| chalcone isomerase [Camellia sinensis] 59 9e-07 gb|AFC37245.1| chalcone isomerase [Camellia chekiangoleosa] 59 9e-07 ref|XP_002272854.2| PREDICTED: uncharacterized protein LOC100243... 55 1e-05 emb|CBI34853.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|NP_001234421.1| CHI protein [Solanum lycopersicum] gi|33867695|gb|AAQ55182.1| putative chalcone isomerase [Solanum lycopersicum] Length = 262 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRA++Y+YLG+DPFDKEAKEKFGT MLSLF Sbjct: 231 LLCRAFIYMYLGDDPFDKEAKEKFGTSMLSLF 262 >ref|XP_002521478.1| conserved hypothetical protein [Ricinus communis] gi|223539377|gb|EEF40968.1| conserved hypothetical protein [Ricinus communis] Length = 268 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAYVY+YLG+DPFDK+AKEKFG +LSLF Sbjct: 237 LLCRAYVYMYLGDDPFDKDAKEKFGMSLLSLF 268 >gb|EXC20353.1| hypothetical protein L484_020574 [Morus notabilis] Length = 326 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAY+++YLG+DPFDKEAKEKFG +LSLF Sbjct: 295 LLCRAYIHMYLGDDPFDKEAKEKFGMSLLSLF 326 >gb|AHB32112.1| chalcone isomerase [Camellia sinensis] Length = 252 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAY ++YLG+DPFDKEAKEKFG +LSLF Sbjct: 221 LLCRAYTHMYLGDDPFDKEAKEKFGMTLLSLF 252 >gb|AFC37245.1| chalcone isomerase [Camellia chekiangoleosa] Length = 252 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAY ++YLG+DPFDKEAKEKFG +LSLF Sbjct: 221 LLCRAYTHMYLGDDPFDKEAKEKFGMTLLSLF 252 >ref|XP_002272854.2| PREDICTED: uncharacterized protein LOC100243977 [Vitis vinifera] Length = 281 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAY+++YLG+D FDK+A+EKFG +LSLF Sbjct: 250 LLCRAYIHMYLGDDAFDKDAREKFGVSLLSLF 281 >emb|CBI34853.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -1 Query: 149 LLCRAYVYLYLGEDPFDKEAKEKFGTKMLSLF 54 LLCRAY+++YLG+D FDK+A+EKFG +LSLF Sbjct: 231 LLCRAYIHMYLGDDAFDKDAREKFGVSLLSLF 262