BLASTX nr result
ID: Catharanthus23_contig00033766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00033766 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443080.1| hypothetical protein SORBIDRAFT_08g007680 [S... 57 3e-06 >ref|XP_002443080.1| hypothetical protein SORBIDRAFT_08g007680 [Sorghum bicolor] gi|241943773|gb|EES16918.1| hypothetical protein SORBIDRAFT_08g007680 [Sorghum bicolor] Length = 649 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/46 (50%), Positives = 34/46 (73%) Frame = -3 Query: 139 MSCITLVSYSIMLNSIPRRPFTPSHGIQEGDLLFFYIFILCSEGFS 2 M C+T VS+SI +N +P + F P+ GI++GD + Y+F+LCSEG S Sbjct: 167 MKCVTTVSFSIRVNGVPTQSFRPTRGIRQGDPISPYLFLLCSEGLS 212