BLASTX nr result
ID: Catharanthus23_contig00031406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00031406 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsi... 56 6e-06 >gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -2 Query: 332 DKSSLPCTICNKMGHEAKSCFQVMGFPDRWLEKNRQHSNRDGRG 201 DKS+L CT CN+ GHE CF V G+PD WLE+N Q + RG Sbjct: 254 DKSTLFCTHCNRKGHEVTQCFLVHGYPDWWLEQNPQENQPSTRG 297