BLASTX nr result
ID: Catharanthus23_contig00030873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030873 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355007.1| PREDICTED: TIMELESS-interacting protein-like... 56 6e-06 >ref|XP_006355007.1| PREDICTED: TIMELESS-interacting protein-like [Solanum tuberosum] Length = 290 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +3 Query: 12 EEHMFNDLWEKAAEGSSQPLHDPSGGAADVHSGGNEQ----PSKPNSTSGAVMISDEQRA 179 +E M ND+WEKA E SQP + AAD SGGN+ P +SG + IS+EQRA Sbjct: 209 QEIMLNDMWEKAIEEPSQPSNQKIV-AADTSSGGNDTVNQAPDNVAKSSGVISISEEQRA 267 Query: 180 RMEVN 194 RME N Sbjct: 268 RMEAN 272