BLASTX nr result
ID: Catharanthus23_contig00030803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030803 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, par... 74 2e-11 gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-cl... 74 2e-11 ref|XP_002334646.1| predicted protein [Populus trichocarpa] 74 2e-11 gb|EMJ15575.1| hypothetical protein PRUPE_ppb016078mg [Prunus pe... 73 5e-11 emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] 73 5e-11 gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus pe... 72 6e-11 gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo s... 72 6e-11 ref|XP_002314375.1| predicted protein [Populus trichocarpa] 72 8e-11 ref|XP_002333404.1| predicted protein [Populus trichocarpa] 72 8e-11 emb|CAN74768.1| hypothetical protein VITISV_031571 [Vitis vinifera] 72 8e-11 ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, part... 72 1e-10 gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus pe... 72 1e-10 emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] 72 1e-10 emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] 71 1e-10 ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581... 71 2e-10 ref|XP_002323146.1| predicted protein [Populus trichocarpa] 71 2e-10 gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. ... 70 3e-10 emb|CAN66878.1| hypothetical protein VITISV_028689 [Vitis vinifera] 70 3e-10 gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus pe... 69 5e-10 gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [... 69 9e-10 >ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] gi|550349763|gb|ERP67127.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] Length = 578 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/45 (68%), Positives = 43/45 (95%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMET 157 SA++MC+QGM+WGL+YIL+GI+P++FEELATRAHDMELS+ +E+ Sbjct: 43 SALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELSIAAVES 87 >gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-class [Cucumis melo subsp. melo] Length = 264 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 SA+EMC QGM+WGL YIL+GI+PRTFEELATRAHDMELS+ + + Sbjct: 128 SAVEMCTQGMHWGLLYILQGIKPRTFEELATRAHDMELSIANRRNND 174 >ref|XP_002334646.1| predicted protein [Populus trichocarpa] Length = 572 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/45 (68%), Positives = 43/45 (95%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMET 157 SA++MC+QGM+WGL+YIL+GI+P++FEELATRAHDMELS+ +E+ Sbjct: 37 SALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELSIAAVES 81 >gb|EMJ15575.1| hypothetical protein PRUPE_ppb016078mg [Prunus persica] Length = 452 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSL 172 SA+E+C+QGM+WGL YILKGI+PR FEELATRAHDMELS+ Sbjct: 87 SAVEICIQGMHWGLLYILKGIKPRMFEELATRAHDMELSI 126 >emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] Length = 331 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 S++EMC+QGM+WGL YIL+GI PRTFEELATRAHDME+S+ + K+ Sbjct: 199 SSVEMCIQGMHWGLLYILQGILPRTFEELATRAHDMEISIANHGVKK 245 >gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus persica] Length = 524 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/47 (65%), Positives = 42/47 (89%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 SA+EMC+QGM+WGL YIL+GI+PRTFEEL TRAHD+ELS+ + + ++ Sbjct: 257 SAVEMCIQGMHWGLLYILQGIKPRTFEELTTRAHDIELSIANHDGRK 303 >gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo subsp. melo] Length = 517 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 SA+EMC QGM+W L YIL+GI+PRTFEELATRAHDMELS+ + K+ Sbjct: 326 SAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMELSIANKGAKD 372 >ref|XP_002314375.1| predicted protein [Populus trichocarpa] Length = 1335 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/39 (76%), Positives = 39/39 (100%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELS 175 SA++MC+QGM+WGL+YIL+GI+P++FEELATRAHDMELS Sbjct: 361 SALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 399 >ref|XP_002333404.1| predicted protein [Populus trichocarpa] Length = 447 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/45 (66%), Positives = 42/45 (93%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMET 157 SA++MC+QGM+WGL+YIL+GI+P++FEELATRAHDM+LS+ E+ Sbjct: 241 SALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMKLSIAAAES 285 >emb|CAN74768.1| hypothetical protein VITISV_031571 [Vitis vinifera] Length = 281 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 285 MEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 MEMC+QGM+WGL YIL+GI+PRTFEELATR HDMEL++ + +K+ Sbjct: 109 MEMCIQGMHWGLLYILQGIRPRTFEELATRVHDMELNIANHGSKK 153 >ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] gi|550317934|gb|ERP49581.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] Length = 440 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/45 (66%), Positives = 41/45 (91%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMET 157 SA++MC+QGM+WGL YIL+GI+P++FEELAT+AHDMELS+ E+ Sbjct: 37 SALDMCIQGMHWGLHYILQGIKPKSFEELATQAHDMELSIATAES 81 >gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus persica] Length = 1078 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSL 172 SA+EMC+QGM+WGL YIL+GI+PRTFEELAT HDMELS+ Sbjct: 366 SAVEMCIQGMHWGLLYILQGIKPRTFEELATHVHDMELSI 405 >emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] Length = 683 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETK 154 S +EMC+QGM+W L YIL+GI+PRTFEELATRAHDMEL++ + + K Sbjct: 265 STVEMCIQGMHWDLLYILQGIRPRTFEELATRAHDMELNIANHDAK 310 >emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] Length = 127 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 SA+EMC+QGM+WG YI +GI+P TFEELATRAHDMELS+ + +K+ Sbjct: 54 SAVEMCIQGMHWGFLYIFQGIRPHTFEELATRAHDMELSIANHGSKK 100 >ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581575, partial [Solanum tuberosum] Length = 910 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/46 (67%), Positives = 41/46 (89%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETK 154 S +EM +QGM+WGL+YIL+GI+P+TFEELATRAHDMELS+ + T+ Sbjct: 351 SGIEMYIQGMHWGLRYILQGIKPKTFEELATRAHDMELSMSSVGTE 396 >ref|XP_002323146.1| predicted protein [Populus trichocarpa] Length = 789 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/45 (66%), Positives = 41/45 (91%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMET 157 SA++MC+QGM+WGL+YIL+GI+P++FEELATRAH MELS+ E+ Sbjct: 280 SALDMCIQGMHWGLRYILQGIKPKSFEELATRAHKMELSIAAAES 324 >gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. melo] Length = 576 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 SA+EMC QGM+W L YIL+GI+PRTFEELATRAHDME S+ + K+ Sbjct: 263 SAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMESSIANRGAKD 309 >emb|CAN66878.1| hypothetical protein VITISV_028689 [Vitis vinifera] Length = 227 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKE 151 S EMC+QGM+WGL YIL+GI+PRTF+ELA RAHDMELS+ + K+ Sbjct: 137 SVGEMCIQGMHWGLLYILQGIRPRTFKELANRAHDMELSIANHNAKK 183 >gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus persica] Length = 468 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSLKHMETKESFR 142 SA+EMC+QGM+WGL YIL+GI+PR+FEEL TR HD+ELS+ + ++ + Sbjct: 246 SAVEMCIQGMHWGLLYILQGIKPRSFEELTTRVHDIELSIASHDGRKEMK 295 >gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [Prunus persica] Length = 536 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -1 Query: 291 SAMEMCVQGMNWGLQYILKGIQPRTFEELATRAHDMELSL-KHMETKE 151 SA+EMC+QGM+W L YIL+GI+PRTFEEL TR HD+ELS+ H KE Sbjct: 361 SAVEMCIQGMHWSLLYILQGIKPRTFEELTTRVHDIELSIANHNGRKE 408