BLASTX nr result
ID: Catharanthus23_contig00030419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030419 (557 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 47 2e-06 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 46.6 bits (109), Expect(3) = 2e-06 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = -3 Query: 438 WLISAVYASPKVKFRSKLWKYM*SLAGRIEWPWLITGDFN 319 WL SA+YASP R +LW+ + + + PWL+ GDFN Sbjct: 101 WLFSAIYASPDSTLRKELWRELEQIKNQYTGPWLLAGDFN 140 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 545 EARGFSEGIWCFW 507 EA GF GIW FW Sbjct: 60 EAEGFRGGIWLFW 72 Score = 23.9 bits (50), Expect(3) = 2e-06 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 253 IEGANLIHLGFPGLKFTWTNVLGQAT 176 IE LI LGF G TW+ L T Sbjct: 167 IENNALIDLGFTGPAHTWSRGLSPTT 192