BLASTX nr result
ID: Catharanthus23_contig00030351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030351 (284 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513355.1| conserved hypothetical protein [Ricinus comm... 50 3e-08 >ref|XP_002513355.1| conserved hypothetical protein [Ricinus communis] gi|223547263|gb|EEF48758.1| conserved hypothetical protein [Ricinus communis] Length = 102 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -2 Query: 283 VAWACDPSGGIKEMEHWA*PAGEVVGGLMLARPFQA 176 V AC+PSGG+K MEHWA P +V G LA PFQA Sbjct: 27 VTRACNPSGGVKVMEHWASPRSRIVNGYCLACPFQA 62 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -1 Query: 173 EWAVLLGRKPGLHSPYSGG*SVRLV*QSSENHPLSAVEG 57 EW L G G P +GG VRL QSS+N PL+AVEG Sbjct: 65 EWCGL-GGGLGRSVPKAGGYRVRLASQSSDNLPLTAVEG 102