BLASTX nr result
ID: Catharanthus23_contig00030189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030189 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354309.1| PREDICTED: uncharacterized protein LOC102580... 44 2e-06 >ref|XP_006354309.1| PREDICTED: uncharacterized protein LOC102580529 [Solanum tuberosum] Length = 486 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +3 Query: 117 MPVVKINVCVNGCMLYWKDDAQAHQCKFCGHE 212 +PV KI+ +GCMLYW DD CKFCG++ Sbjct: 190 LPVEKIDCYESGCMLYWGDDDNLTSCKFCGNQ 221 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +1 Query: 40 ILKDLLPKHKKVVDNLYQTKKLVSGI 117 +LKD LP+ V+DN YQTKKLV + Sbjct: 163 LLKDSLPEDNIVLDNYYQTKKLVRSL 188