BLASTX nr result
ID: Catharanthus23_contig00030175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030175 (322 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251087.1| PREDICTED: transcription factor E2FB-like [S... 67 3e-09 ref|XP_006362858.1| PREDICTED: transcription factor E2FB-like [S... 66 6e-09 emb|CBI28269.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [V... 65 1e-08 emb|CCF72392.1| transcription factor E2FB [Nicotiana tabacum] 64 2e-08 emb|CAC17702.1| transcription factor (E2F) [Oxybasis rubra] 60 2e-07 ref|XP_002312830.1| E2F transcription factor-1 family protein [P... 56 6e-06 dbj|BAA86386.1| transcription factor [Nicotiana tabacum] 55 8e-06 >ref|XP_004251087.1| PREDICTED: transcription factor E2FB-like [Solanum lycopersicum] Length = 449 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHS-PPQPEEMPSTSNHPG 176 TDMWRTES +DWNELD I E Y++ANVSTP A + PP E+PS +N G Sbjct: 399 TDMWRTESAIDWNELDVIQEDYSIANVSTPRAQTPPPATTEVPSAANTSG 448 >ref|XP_006362858.1| PREDICTED: transcription factor E2FB-like [Solanum tuberosum] Length = 448 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHS-PPQPEEMPSTSNHPG 176 TDMWRTES +DWNELD I E Y++ANVSTP A + PP E+PS +N G Sbjct: 398 TDMWRTESAIDWNELDVIQEDYSIANVSTPRAQTPPPATTEVPSAANTYG 447 >emb|CBI28269.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPP-QPEEMPSTSNHPG 176 TDMWRTE GV+WNELD + + Y MANVSTP +PP E+P +N PG Sbjct: 396 TDMWRTEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPAANTPG 445 >ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [Vitis vinifera] Length = 457 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPP-QPEEMPSTSNHPG 176 TDMWRTE GV+WNELD + + Y MANVSTP +PP E+P +N PG Sbjct: 407 TDMWRTEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPAANTPG 456 >emb|CCF72392.1| transcription factor E2FB [Nicotiana tabacum] Length = 449 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPP-QPEEMPSTSNHPG 176 TDMWRTES +DWNELD I E +++ANVSTP + +PP E+PS +N G Sbjct: 399 TDMWRTESAIDWNELDVIQEDFSIANVSTPRSETPPTNTTEVPSAANTTG 448 >emb|CAC17702.1| transcription factor (E2F) [Oxybasis rubra] Length = 454 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPP 215 TDMWRT+SGV+WNEL TI E YT+ANV TP SPP Sbjct: 405 TDMWRTDSGVEWNELGTIHEDYTVANVGTPQPQSPP 440 >ref|XP_002312830.1| E2F transcription factor-1 family protein [Populus trichocarpa] gi|222849238|gb|EEE86785.1| E2F transcription factor-1 family protein [Populus trichocarpa] Length = 473 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/46 (50%), Positives = 29/46 (63%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPPQPEEMPSTSN 185 TDMWR E V+WN+LDT+ Y M N STP +P P E+P +N Sbjct: 424 TDMWRNEPVVEWNDLDTLHNDYVMPNFSTPQPQTPSNPTEVPPAAN 469 >dbj|BAA86386.1| transcription factor [Nicotiana tabacum] Length = 439 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -1 Query: 322 TDMWRTESGVDWNELDTIPETYTMANVSTPVAHSPPQPEEMPSTSNHPGS 173 TD+WR +S +DWNEL+ I E Y++ANVSTP A +PP ++N GS Sbjct: 390 TDIWRADSVLDWNELNVIHEDYSIANVSTPRAQTPPSSTTELPSANTTGS 439