BLASTX nr result
ID: Catharanthus23_contig00030168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030168 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004295934.1| PREDICTED: glycine-rich RNA-binding protein ... 55 1e-05 >ref|XP_004295934.1| PREDICTED: glycine-rich RNA-binding protein 2, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 108 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 221 LSSTKFFVGGLLYDTNETILKDAFKPHGEIIE 316 LSSTK FVGGL YDTNE +LKDAF HGEIIE Sbjct: 26 LSSTKLFVGGLSYDTNEPVLKDAFGKHGEIIE 57