BLASTX nr result
ID: Catharanthus23_contig00030054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00030054 (257 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632272.1| PREDICTED: shugoshin-1-like [Vitis vinifera] 58 1e-06 emb|CBI17144.3| unnamed protein product [Vitis vinifera] 58 1e-06 gb|EOY18839.1| Shugoshin C terminus, putative isoform 2 [Theobro... 57 2e-06 gb|EOY18838.1| Shugoshin C terminus, putative isoform 1 [Theobro... 57 2e-06 gb|EOY34492.1| Shugoshin C terminus, putative [Theobroma cacao] 57 3e-06 ref|XP_006384956.1| hypothetical protein POPTR_0004s22560g [Popu... 56 4e-06 ref|XP_002331453.1| predicted protein [Populus trichocarpa] 56 4e-06 ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera]... 56 6e-06 >ref|XP_003632272.1| PREDICTED: shugoshin-1-like [Vitis vinifera] Length = 297 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 31 EKHGGSISKRAERTSIGRPLRKAAEKVQSYKEIPLNTKMRR 153 EKH ++ ++R+SIGRPLR+AAEKVQSYKE PLNTKMRR Sbjct: 258 EKHE---ARGSQRSSIGRPLRRAAEKVQSYKEAPLNTKMRR 295 >emb|CBI17144.3| unnamed protein product [Vitis vinifera] Length = 292 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 31 EKHGGSISKRAERTSIGRPLRKAAEKVQSYKEIPLNTKMRR 153 EKH ++ ++R+SIGRPLR+AAEKVQSYKE PLNTKMRR Sbjct: 253 EKHE---ARGSQRSSIGRPLRRAAEKVQSYKEAPLNTKMRR 290 >gb|EOY18839.1| Shugoshin C terminus, putative isoform 2 [Theobroma cacao] Length = 381 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 5/50 (10%) Frame = +1 Query: 25 KDEKHGGSISKRAE-----RTSIGRPLRKAAEKVQSYKEIPLNTKMRRND 159 K E GSI+ R E R S+GRPLR+A EKVQSYKEIP+N KMRR + Sbjct: 332 KKEHEEGSITPRNEAQELRRISVGRPLRRAVEKVQSYKEIPVNVKMRREE 381 >gb|EOY18838.1| Shugoshin C terminus, putative isoform 1 [Theobroma cacao] Length = 382 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 5/50 (10%) Frame = +1 Query: 25 KDEKHGGSISKRAE-----RTSIGRPLRKAAEKVQSYKEIPLNTKMRRND 159 K E GSI+ R E R S+GRPLR+A EKVQSYKEIP+N KMRR + Sbjct: 333 KKEHEEGSITPRNEAQELRRISVGRPLRRAVEKVQSYKEIPVNVKMRREE 382 >gb|EOY34492.1| Shugoshin C terminus, putative [Theobroma cacao] Length = 302 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 64 ERTSIGRPLRKAAEKVQSYKEIPLNTKMRRND 159 +R S GRPLRKAAEKVQSYKE+PLN KMRR D Sbjct: 271 KRPSFGRPLRKAAEKVQSYKEVPLNVKMRRED 302 >ref|XP_006384956.1| hypothetical protein POPTR_0004s22560g [Populus trichocarpa] gi|550341724|gb|ERP62753.1| hypothetical protein POPTR_0004s22560g [Populus trichocarpa] Length = 303 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/46 (60%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +1 Query: 19 VAKDEKHG-GSISKRAERTSIGRPLRKAAEKVQSYKEIPLNTKMRR 153 + K+E G G+ ++ + R+SIGRPLR+AAEKVQSYKE+P+N KMRR Sbjct: 250 ITKEETCGAGNEAQVSLRSSIGRPLRRAAEKVQSYKEVPVNVKMRR 295 >ref|XP_002331453.1| predicted protein [Populus trichocarpa] Length = 119 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/46 (60%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +1 Query: 19 VAKDEKHG-GSISKRAERTSIGRPLRKAAEKVQSYKEIPLNTKMRR 153 + K+E G G+ ++ + R+SIGRPLR+AAEKVQSYKE+P+N KMRR Sbjct: 66 ITKEETCGAGNEAQVSLRSSIGRPLRRAAEKVQSYKEVPVNVKMRR 111 >ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera] gi|296085974|emb|CBI31415.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 67 RTSIGRPLRKAAEKVQSYKEIPLNTKMRRND 159 R+SIGRPLR+AAEKVQSYKEIP+N KMRR++ Sbjct: 287 RSSIGRPLRRAAEKVQSYKEIPINVKMRRSE 317