BLASTX nr result
ID: Catharanthus23_contig00029203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029203 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB63590.1| hypothetical protein L484_026929 [Morus notabilis] 55 7e-06 ref|XP_003522958.1| PREDICTED: organ-specific protein S2-like [G... 55 7e-06 >gb|EXB63590.1| hypothetical protein L484_026929 [Morus notabilis] Length = 106 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = -2 Query: 264 AGEYWKRVMGNKPMPKAIRDLIIIRGREDSTAAATPSIKQKHFATNFDTMPNVIIYHS 91 AGEYW +M ++P+P+AIRDL +D + T K F +FD PNVIIYHS Sbjct: 26 AGEYWNSIMKDQPIPEAIRDLFY---DQDLPSDLTGPTKHDRFVRDFDVQPNVIIYHS 80 >ref|XP_003522958.1| PREDICTED: organ-specific protein S2-like [Glycine max] Length = 97 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -2 Query: 261 GEYWKRVMGNKPMPKAIRDLIIIRGREDSTAAATPSIKQKHFATNFDTMPNVIIYHS*VI 82 G YWK VM +PMP+AI+DL+ EDS A+A K+ F +FD PNVI+YH+ V+ Sbjct: 27 GWYWKNVMKEQPMPQAIKDLV-----EDSQASAAG--KKDRFIRDFDVKPNVILYHTHVV 79