BLASTX nr result
ID: Catharanthus23_contig00029127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029127 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 110 2e-22 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 92 7e-17 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 110 bits (275), Expect = 2e-22 Identities = 57/74 (77%), Positives = 61/74 (82%) Frame = +2 Query: 32 GGGITPFSKKPYVTLSRHTAPSRNQDLPFPLTNGSSNQPR*AFFFIHSLIDSKVVLACFQ 211 GGGITPFSK+PYVTLSRHTAPSRN+DLPFPLTNGSSNQP F+ S V +ACFQ Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQPVPPFY-------SSVAVACFQ 72 Query: 212 VQALAVEASRQKQT 253 VQALAVEASRQK T Sbjct: 73 VQALAVEASRQKLT 86 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLRGPLVGPVRWWYHTLLKETIRDTLASYGSVPESG-PPLSFDQRVLKPT 147 QLRGPLVGP RWWYHTLLK T+RDTLASYGS PESG PP SFDQRVL+PT Sbjct: 2 QLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPT 51