BLASTX nr result
ID: Catharanthus23_contig00029079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029079 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611775.1| hypothetical protein MTR_5g017710 [Medicago ... 57 3e-06 ref|XP_003636987.1| hypothetical protein MTR_066s1016 [Medicago ... 56 6e-06 ref|XP_006425856.1| hypothetical protein CICLE_v10027106mg [Citr... 55 1e-05 >ref|XP_003611775.1| hypothetical protein MTR_5g017710 [Medicago truncatula] gi|355513110|gb|AES94733.1| hypothetical protein MTR_5g017710 [Medicago truncatula] Length = 85 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 8/85 (9%) Frame = +2 Query: 62 MANISCKCLFMIFLLILVSIEQVPISVEGRNLRGEKVKVRILGQETRNRA--------EK 217 MA+ + CL IF+L+L+S E +S+EGR+LR + ET R+ + Sbjct: 1 MAHFTRSCL--IFVLLLISCEL--LSIEGRSLRKSIGSPKAASVETMTRSVVLSPRQLQN 56 Query: 218 SRRVLQGEVDSFRPTNPGRSPGIGH 292 + R L+G V++FRPT PG SPG+GH Sbjct: 57 NGRNLEGSVEAFRPTTPGHSPGVGH 81 >ref|XP_003636987.1| hypothetical protein MTR_066s1016 [Medicago truncatula] gi|355502922|gb|AES84125.1| hypothetical protein MTR_066s1016 [Medicago truncatula] gi|388514207|gb|AFK45165.1| unknown [Medicago truncatula] Length = 82 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 3/80 (3%) Frame = +2 Query: 62 MANISCKCLFMIFLLILVSIEQVPISVEGRNLRGEKVKVRILGQETRNRAE---KSRRVL 232 MA+++ CLF ++L+ +S E + + EGR+LR I + + ++ +S R L Sbjct: 1 MAHLARICLF--YVLLFLSHELLLTTTEGRSLRQSIQPPNIASTKMMSTSQLYHRSNRSL 58 Query: 233 QGEVDSFRPTNPGRSPGIGH 292 +G+V++FRPT PG SPGIGH Sbjct: 59 EGDVEAFRPTTPGHSPGIGH 78 >ref|XP_006425856.1| hypothetical protein CICLE_v10027106mg [Citrus clementina] gi|557527846|gb|ESR39096.1| hypothetical protein CICLE_v10027106mg [Citrus clementina] Length = 93 Score = 55.1 bits (131), Expect = 1e-05 Identities = 36/97 (37%), Positives = 49/97 (50%), Gaps = 20/97 (20%) Frame = +2 Query: 62 MANISCKCLFMIFLLILVSIEQVPISVEGRNLRGEKV--------------KVRILGQET 199 MAN+SC CLF F+L++ S E VEGRNL+ K K + + ++T Sbjct: 1 MANVSCTCLF--FILMIFSHELC--DVEGRNLKISKSLKCAKCLLSPDGQSKSKPIARDT 56 Query: 200 RNR------AEKSRRVLQGEVDSFRPTNPGRSPGIGH 292 N + +G VD+FRPT PG SPG+GH Sbjct: 57 NNHDASPSLLHHGTKTTEGFVDAFRPTTPGHSPGVGH 93