BLASTX nr result
ID: Catharanthus23_contig00029025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029025 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|AB... 67 2e-09 >ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|ABP35486.1| ORF67g [Pinus koraiensis] Length = 67 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 177 MRAGKGYNSAVECHLDVVEVISSSLIIPKPNVSFSI 284 MR GKGYNSAVECHLD+VEVISSSLIIPKPNVS SI Sbjct: 1 MRVGKGYNSAVECHLDMVEVISSSLIIPKPNVSPSI 36